LOADING...
   TM0438;TM0438
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0438    TM0438            JCSG 282311 Protein Purification 01-DEC-06

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0438
DESCRIPTION6-phosphogluconate dehydrogenase, decarboxylating.
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9WYR9_THEMA
DR SPTR; Q9WYR9 (flat text); Q9WYR9 (good view)
DR GenBank; AAD35523
DR Pfam; PF00393; 6PGD;
DR Pfam; PF03446; NAD_binding_2;
DR Interpro; IPR006183; 6PGD;
DR Interpro; IPR006114; 6PGD_C;
DR Interpro; IPR006113; 6PGD_decarbox;
DR Interpro; IPR006115; 6PGD_NAD;
DR PDB; 2W8Z; Highly similar; 07-APR-09; 6-PHOSPHOGLUCONATE DEHYDROGENASE, DECARBOXYLATING;
DR PDB; 2W90; Highly similar; 07-APR-09; 6-PHOSPHOGLUCONATE DEHYDROGENASE, DECARBOXYLATING CHAIN: A,;
DR PDB; 2ZYG; Highly similar; 01-SEP-09; 6-PHOSPHOGLUCONATE DEHYDROGENASE, DECARBOXYLATING CHAIN: A,;
DR PDB; 2ZYA; Highly similar; 01-SEP-09; 6-PHOSPHOGLUCONATE DEHYDROGENASE, DECARBOXYLATING CHAIN: A,;
DR PDB; 2ZYD; Highly similar; 01-SEP-09; 6-PHOSPHOGLUCONATE DEHYDROGENASE, DECARBOXYLATING CHAIN: A,;
DR PDB; 3FWN; Highly similar; 01-SEP-09; 6-PHOSPHOGLUCONATE DEHYDROGENASE, DECARBOXYLATING CHAIN: A,;
DR PDB; 2IYO; Highly similar; 23-JAN-07; 6-PHOSPHOGLUCONATE DEHYDROGENASE, DECARBOXYLATING;
DR PDB; 2IYP; Highly similar; 23-JAN-07; 6-PHOSPHOGLUCONATE DEHYDROGENASE, DECARBOXYLATING;
DR FFAS; 282311; Fold and function assignment.
DR TVPC; TM0438; Homologs in PDB, JCSG and SG center.
DR OVP; TM0438; Ortholog view popup.
DR TPM; TM0438; Target PDB monitor.
DR FSS; TM0438; Target function coverage.
PROPERTY Residues: 469 aa
Molecule Weight: 53016.04 Dalton
Isoelectric Point: 5.79
Extinction Coefficient: 51340
Gravy Index: -.24
Number of Met residues: 16
Percentage of Met residues: 3.41 %
Number of Cys residues: 3
Percentage of Cys residues: 0.64 %
SEQUENCE  amino acids 469 aa
>TM0438  TM0438 6-phosphogluconate dehydrogenase, decarboxylating (gnd)
MKSHIGLIGLAVMGQNLALNIARKGYKVSVYNRTAQRTEEFVKNRVTNEEIEPHYDIESF
VKSLERPRKIILMVKAGKPVDDTISQLLPHLEPGDLIIDGGNSHYMDTERRFKELSEKGI
LFLGMGVSGGEYGALHGPSLMPGGSREAYNLVEEILLEIAAKTEDGPCCTYVGERSAGHF
VKMVHNGIEYAIMQAIAEVYHIMRDVLSLSSEEMSSIFEEWNRGELSSFLVEITYKILRK
KDEETGKPMVDVILDKAEQKGTGKWTSQAALDLGIPTPSINLAVVERVISHFKDIRTRLS
KLYNKRRSATQGSEEFLRDLRNSLFFAMFMAFSQGMWLIAEASKEFGYGVSLSEVLRIWK
GGCIIRAKLIDTLRRYISNENAYLLENEEVMNLLKGKIDSLKNILKASIENEIPVPVLSS
SYNYFMSLTEERLPANLIQAQRDFFGAHTFERVDREGVFHINWEEGEIG

CDS  cDNA 1407 bp
   1 gtgaaatctc atattggtct catcggtctt gctgtgatgg gtcagaatct tgcactgaac    60
  61 attgcgagga aaggctacaa agtttcggtt tacaacagaa cagcacagag aacggaggaa   120
 121 tttgtgaaaa atcgtgtaac gaatgaagag atagaacctc attacgatat cgaaagcttc   180
 181 gtgaagtctc tcgaaagacc aagaaagata atcttaatgg taaaggcagg aaaacccgtg   240
 241 gatgatacga tttctcagct tcttcctcac ctcgaaccag gtgatttgat aatagacggt   300
 301 ggtaattccc attacatgga taccgaaaga cgcttcaagg aactctctga aaagggaata   360
 361 cttttcctcg gtatgggagt ttctggtggt gagtacgggg ctcttcacgg gccttctctc   420
 421 atgcctgggg gaagtagaga agcgtacaac ctggttgagg agattctttt ggaaatagca   480
 481 gcgaaaacag aggatggacc atgctgtaca tacgttggtg aaagatcagc gggccacttt   540
 541 gtgaagatgg ttcacaacgg catagaatac gccatcatgc aggcgatagc ggaagtttat   600
 601 cacattatga gagatgtttt gagcctatca tctgaagaaa tgtccagtat ctttgaagag   660
 661 tggaacagag gagaactcag ctcgttcctg gtggagatca cctacaagat tttgagaaag   720
 721 aaagatgaag aaacaggaaa accgatggtc gatgtgattc tggacaaggc ggaacaaaag   780
 781 ggaactggaa agtggacatc ccaagcagcc cttgacctcg gaatacctac cccttccata   840
 841 aacctggcgg tggttgaaag ggtgatttcc catttcaaag acataagaac aaggctttcg   900
 901 aaactgtata ataagagaag aagcgctact cagggtagcg aggaattttt gagagatctc   960
 961 cgaaactctc tcttctttgc catgttcatg gccttttctc agggcatgtg gttgatcgca  1020
1021 gaagcatcga aagagttcgg ctatggggtg agcctctcgg aggtgctcag aatatggaag  1080
1081 ggtggatgta tcataagggc gaagttgata gacacactca gaaggtacat atctaacgag  1140
1141 aacgcgtatt tgctggagaa cgaagaagtg atgaatctat tgaaaggcaa aatcgattct  1200
1201 ctaaagaaca tattgaaggc gtccatagag aacgaaatcc ccgttcctgt tttgagttcc  1260
1261 tcttacaact acttcatgag tcttaccgaa gagagactgc cggcgaatct catacaggct  1320
1321 caaagagact tcttcggagc acacactttt gagagagtag acagagaagg tgtgttccac  1380
1381 atcaactggg aggaaggaga gatagga  1407
Warning: the change of start codon from ATG/M to GTG/V;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
459482 460891 2 Glimmer3 score 11.94 poor
Genemark probabilities .89   .98 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu