LOADING...
   TM0545;TM0545
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0545    TM0545            JCSG 282418 Protein Purification 05-MAY-18

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0545
DESCRIPTIONHomoserine kinase (EC 2.7.1.39) (HK).
ORGANISMThermotoga maritima
COMMENT-!- CATALYTIC ACTIVITY: ATP + L-HOMOSERINE = ADP + O-PHOSPHO-L-
HOMOSERINE.
-!- PATHWAY: THREONINE BIOSYNTHESIS FROM ASPARATE; FOURTH STEP.
-!- SUBCELLULAR LOCATION: CYTOPLASMIC (POTENTIAL).
-!- SIMILARITY: BELONGS TO THE GHMP KINASE FAMILY. HOMOSERINE KINASE
SUBFAMILY.
--------------------------------------------------------------------------
This SWISS-PROT entry is copyright. It is produced through a collaboration
between the Swiss Institute of Bioinformatics and the EMBL outstation -
the European Bioinformatics Institute. There are no restrictions on its
use by non-profit institutions as long as its content is in no way
modified and this statement is not removed. Usage by and for commercial
entities requires a license agreement (See http://www.isb-sib.ch/announce/
or send an email to license@isb-sib.ch).
--------------------------------------------------------------------------
DR UNIPROT; KHSE_THEMA
DR SPTR; Q9WZ15 (flat text); Q9WZ15 (good view)
DR GenBank; AAD35630
DR Pfam; PF00288; GHMP_kinases_N;
DR Interpro; IPR006204; GHMP_kinase;
DR Interpro; IPR006203; GHMPknse_ATP;
DR Interpro; IPR000870; Homoser_kin;
DR PDB; 3HUL; Highly similar; 14-JUL-09; HOMOSERINE KINASE;
DR PDB; 4P52; Highly similar; 02-APR-14; HOMOSERINE KINASE;
DR KEGG; 2.7.1.39; Enzyme page
DR FFAS; 282418; Fold and function assignment.
DR TVPC; TM0545; Homologs in PDB, JCSG and SG center.
DR OVP; TM0545; Ortholog view popup.
DR TPM; TM0545; Target PDB monitor.
DR FSS; TM0545; Target function coverage.
PROPERTY Residues: 281 aa
Molecule Weight: 31294.33 Dalton
Isoelectric Point: 6.26
Extinction Coefficient: 15930
Gravy Index: -.09
Number of Met residues: 5
Percentage of Met residues: 1.78 %
Number of Cys residues: 5
Percentage of Cys residues: 1.78 %
SEQUENCE  amino acids 281 aa
>TM0545  TM0545 homoserine kinase, putative
MKVLVPATTTNLGAGFDVFGLALDLFNEVEFSFDTKETTIESTGKYASDLKDHNLFFEVL
RFFERKTGYRVPPVRIKQTCNIPVSSGLGSSAAVIVAALHIANEGTGRNLSREDLMKLAV
ELEGHPDNVVPAFTGGLVVCYQNGSHLDFEKFEIDLSLTFLVPNFPVCTNEMRKILPEKV
PFEDAVFNIKNSCQFLAKIAAGKIKEALKYVGDRLHQNYRINGNKKMKEFVEAILSKNPE
YWFVSGSGPSVCSNINDFEGIPYLKDVLKLRVNNRGMIVSE

CDS  cDNA 843 bp
   1 atgaaggtcc tggtaccggc cacaacgacc aatctcggag cgggattcga cgtctttgga    60
  61 ctcgcgctgg atcttttcaa cgaagtggag ttttctttcg atacaaaaga gacaaccata   120
 121 gaaagtactg gaaaatacgc ttcggatttg aaggaccaca atctgttttt cgaagtcctc   180
 181 aggttctttg agagaaaaac cgggtacaga gttccgccag tcaggatcaa gcagacatgc   240
 241 aacatccctg tatcgagcgg tcttggatcg agcgccgctg tgatcgtcgc ggcactccac   300
 301 attgcgaacg aaggaacggg cagaaatctt tcacgggaag atctcatgaa actcgctgtg   360
 361 gagctggaag gacaccctga caacgttgta cccgctttca caggggggct tgtggtctgt   420
 421 tatcaaaacg gaagtcatct tgattttgaa aagttcgaga tcgatctttc tctcacattt   480
 481 cttgttccga attttccagt atgtacaaac gagatgagaa agatccttcc ggagaaggtc   540
 541 cctttcgaag atgcggtctt caacataaag aattcatgcc agttccttgc aaagatcgca   600
 601 gctggaaaga tcaaagaggc tctgaaatac gtgggagatc gacttcacca gaactacagg   660
 661 ataaacggca ataagaagat gaaagagttt gtggaagcca tcttatcaaa aaatcccgag   720
 721 tactggtttg taagcggatc cggtccttct gtttgttcca atataaatga ctttgaaggg   780
 781 attccctatc tcaaggacgt tctgaagctg agggtgaaca acagggggat gatagtttca   840
 841 gaa   843
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
570322 571167 -1 Glimmer3 score 12.51 good
Genemark probabilities .82   .93 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu