LOADING...
   TM0546;TM0546
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0546    TM0546            JCSG 282419 Crystal Hit 01-OCT-17

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0546
DESCRIPTIONThreonine synthase (EC 4.2.3.1)
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9WZ16_THEMA
DR SPTR; Q9WZ16 (flat text); Q9WZ16 (good view)
DR GenBank; AAD35631
DR Pfam; PF00291; PALP;
DR Interpro; IPR001926; B6_enzyme_beta;
DR Interpro; IPR000634; S/T_dehydrtse_BS;
DR Interpro; IPR004450; Thr_synthase;
DR PDB; 2ZSJ; Highly similar; 21-OCT-08; THREONINE SYNTHASE;
DR PDB; 1UIM; Highly similar; 18-NOV-03; THREONINE SYNTHASE;
DR PDB; 1UIN; Highly similar; 18-NOV-03; THREONINE SYNTHASE;
DR PDB; 1V7C; Highly similar; 30-DEC-03; THREONINE SYNTHASE;
DR PDB; 3AEX; Highly similar; 17-NOV-10; THREONINE SYNTHASE;
DR PDB; 3AEY; Highly similar; 17-NOV-10; THREONINE SYNTHASE;
DR PDB; 2D1F; Highly similar; 05-SEP-06; THREONINE SYNTHASE;
DR PDB; 1E5X; Highly similar; 02-AUG-01; THREONINE SYNTHASE;
DR KEGG; 4.2.3.1; Enzyme page
DR FFAS; 282419; Fold and function assignment.
DR TVPC; TM0546; Homologs in PDB, JCSG and SG center.
DR OVP; TM0546; Ortholog view popup.
DR TPM; TM0546; Target PDB monitor.
DR FSS; TM0546; Target function coverage.
PROPERTY Residues: 348 aa
Molecule Weight: 37759.59 Dalton
Isoelectric Point: 6.48
Extinction Coefficient: 28880
Gravy Index: -.06
Number of Met residues: 10
Percentage of Met residues: 2.87 %
Number of Cys residues: 4
Percentage of Cys residues: 1.15 %
SEQUENCE  amino acids 348 aa
>TM0546  TM0546 threonine synthase (thrC)
MKLGILEKYRRFLPVTDKTPMLSLNEGNTPLIPLVNMSRELGINIYVKYEGSNPTGSFKD
RGMVVAVAKALEEGSKAIMCASTGNTSASAAAYAARAGIKAIVLIPEGKIALGKLAQAMI
YGAVVLQVRGNFDKCLELVKEITSKYPITLVNSINPYRLEGQKTAAFEIVDELGDAPDYH
FIPVGNAGNISAYWMGYKEYYQHGFSTKLPKMMGFQAEGAAPIVRGHPIENPETVATAIR
IGNPANWEKAVRARDESGGDIDMVSDEEILRAQRLLAQKEGIFCEPASAASIAGLLKKHR
QGIFRGGEIVVCTLTGNGLKDPNIVISQLEPPRIIEGRVEEILEVLDI

CDS  cDNA 1044 bp
   1 atgaaattgg gcatactcga aaagtacaga agatttcttc ccgtaacaga caaaacccct    60
  61 atgctctctt tgaatgaagg gaacactcct ctcatacctc ttgtgaacat gagcagggaa   120
 121 ctcggaataa acatctacgt gaagtacgaa ggatccaatc cgacggggtc cttcaaagat   180
 181 agaggaatgg tcgttgccgt cgcaaaggca ctggaagaag gctcgaaagc catcatgtgc   240
 241 gcttcaacgg ggaacacctc cgcatccgct gccgcgtacg ccgcaagggc aggaataaag   300
 301 gcgatcgttc tgataccaga agggaagatc gcactcggaa agctggctca ggcgatgata   360
 361 tacggcgccg tggtgcttca ggtgagaggg aatttcgaca agtgtctgga actggtcaag   420
 421 gagatcacat ccaaatatcc catcacactc gtgaacagta tcaatcccta cagactcgaa   480
 481 ggtcagaaaa cggccgcttt tgagatagtc gacgagctcg gagatgcacc ggactaccac   540
 541 ttcatccccg tgggaaacgc gggcaacatc tccgcttact ggatgggata caaggagtat   600
 601 tatcagcatg ggttctccac caaactgccg aagatgatgg gattccaggc ggaaggggcc   660
 661 gcccccatag ttcgcggtca tcccatagaa aacccggaga cggtcgccac tgcaataagg   720
 721 atcggtaacc ccgcgaactg ggaaaaagcg gtccgggcac gcgatgaatc gggtggagac   780
 781 atcgacatgg tgagcgacga agaaatactg cgcgcacaga gactcttggc tcagaaagaa   840
 841 gggatcttct gtgagcccgc atccgctgca tcgatagcgg ggcttttgaa gaagcacaga   900
 901 cagggaatct tcaggggtgg agagatcgtt gtgtgtaccc tcacagggaa cggtttgaaa   960
 961 gatccgaaca tcgtcatctc acagcttgaa cccccaagga tcatagaagg aagagtagaa  1020
1021 gagattctgg aggtactcga cata  1044
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
571164 572210 -3 Glimmer3 score - -
Genemark probabilities .94   .92 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu