LOADING...
   TM0686;TM0686
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0686    TM0686            JCSG 282556 Crystal Hit 01-OCT-23

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0686
DESCRIPTIONDNA polymerase III, gamma and TAU subunit.
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9WZF2_THEMA
DR SPTR; Q9WZF2 (flat text); Q9WZF2 (good view)
DR GenBank; AAD35768
DR Pfam; PF00004; AAA;
DR Interpro; IPR003593; AAA_ATPase;
DR Interpro; IPR003959; AAA_ATPase_centr;
DR Interpro; IPR000862; RFCdomain;
DR PDB; 1JR3; Highly similar; 26-SEP-01; DNA POLYMERASE III SUBUNIT GAMMA;
DR PDB; 1XXH; Highly similar; 07-DEC-04; DNA POLYMERASE III, DELTA SUBUNIT;
DR PDB; 1XXI; Highly similar; 07-DEC-04; DNA POLYMERASE III, DELTA SUBUNIT;
DR PDB; 3GLF; Highly similar; 26-MAY-09; DNA POLYMERASE III SUBUNIT DELTA;
DR PDB; 3GLI; Highly similar; 26-MAY-09; DNA POLYMERASE III SUBUNIT DELTA;
DR PDB; 3GLH; Highly similar; 26-MAY-09; DNA POLYMERASE III SUBUNIT DELTA;
DR PDB; 3GLG; Highly similar; 26-MAY-09; DNA POLYMERASE III SUBUNIT DELTA;
DR FFAS; 282556; Fold and function assignment.
DR TVPC; TM0686; Homologs in PDB, JCSG and SG center.
DR OVP; TM0686; Ortholog view popup.
DR TPM; TM0686; Target PDB monitor.
DR FSS; TM0686; Target function coverage.
PROPERTY Residues: 478 aa
Molecule Weight: 54814.05 Dalton
Isoelectric Point: 5.59
Extinction Coefficient: 24870
Gravy Index: -.42
Number of Met residues: 9
Percentage of Met residues: 1.88 %
Number of Cys residues: 6
Percentage of Cys residues: 1.26 %
SEQUENCE  amino acids 478 aa
>TM0686  TM0686 DNA polymerase III, gamma and tau subunit (dnaZX)
MEVLYRKYRPKTFSEVVNQDHVKKAIIGAIQKNSVAHGYIFAGPRGTGKTTLARILAKSL
NCENRKGVEPCNSCRACREIDEGTFMDVIELDAASNRGIDEIRRIRDAVGYRPMEGKYKV
YIIDEVHMLTKEAFNALLKTLEEPPSHVVFVLATTNLEKVPPTIISRCQVFEFRNIPDEL
IEKRLQEVAEAEGIEIDREALSFIAKRASGGLRDALTMLEQVWKFSEGKIDLETVHRALG
LIPIQVVRDYVNAIFSGDVKRVFTVLDDVYYSGKDYEVLIQEAVEDLVEDLERERGVYQV
SANDIVQVSRQLLNLLREIKFAEEKRLVCKVGSAYIATRFSTTNVQENDVREKNDNSNVQ
QKEEKKETVKAKEEKQEDSEFEKRFKELMEELKEKGDLSIFVALSLSEVQFDGEKVIISF
DSSKAMHYELMKKKLPELENIFSRKLGKKVEVELRLMGKEETIEKVSQKILRLFEQEG

CDS  cDNA 1434 bp
   1 gtggaagttc tttacaggaa gtacaggcca aagacttttt ctgaggttgt caatcaggat    60
  61 catgtgaaga aggcaataat cggtgctatt cagaagaaca gcgtggccca cggatacata   120
 121 ttcgccggtc cgaggggaac ggggaagact actcttgcca gaattctcgc aaaatccctg   180
 181 aactgtgaga acagaaaggg agttgaaccc tgcaattcct gcagagcctg cagagagata   240
 241 gacgagggaa ccttcatgga cgtgatagag ctcgacgcgg cctccaacag aggaatagac   300
 301 gagatcagaa gaatcagaga cgccgttgga tacaggccga tggaaggtaa atacaaagtc   360
 361 tacataatag acgaagttca catgctcacg aaagaagcct tcaacgcgct cctcaaaaca   420
 421 ctcgaagaac ctccttccca cgtcgtgttc gtgctggcaa cgacaaacct tgagaaggtt   480
 481 cctcccacga ttatctcgag atgtcaggtt ttcgagttca gaaacattcc cgacgagctc   540
 541 atcgaaaaga ggctccagga agttgcggag gctgaaggaa tagagataga cagggaagct   600
 601 ctgagcttca tcgcaaaaag agcctctgga ggcttgagag acgcgctcac catgctcgag   660
 661 caggtgtgga agttctcgga aggaaagata gatctcgaga cggtacacag ggcgctcggg   720
 721 ttgataccga tacaggttgt tcgcgattac gtgaacgcta tcttttctgg tgatgtgaaa   780
 781 agggtcttca ccgttctcga cgacgtctat tacagcggga aggactacga ggtgctcatt   840
 841 caggaagcag tcgaggatct ggtcgaagac ctggaaaggg agagaggggt ttaccaggtt   900
 901 tcagcgaacg atatagttca ggtttcgaga caacttctga atcttctgag agagataaag   960
 961 ttcgccgaag aaaaacgact cgtctgtaaa gtgggttcgg cttacatagc gacgaggttc  1020
1021 tccaccacaa acgttcagga aaacgatgtc agagaaaaaa acgataattc aaatgtacag  1080
1081 cagaaagaag agaagaaaga aacggtgaag gcaaaagaag aaaaacagga agacagcgag  1140
1141 ttcgagaaac gcttcaaaga actcatggaa gaactgaaag aaaagggcga tctctctatc  1200
1201 tttgtcgctc tcagcctctc agaggtgcag tttgacggag aaaaggtgat tatttctttt  1260
1261 gattcatcga aagctatgca ttacgagttg atgaagaaaa aactgcctga gctggaaaac  1320
1321 attttttcta gaaaactcgg gaaaaaagta gaagttgaac ttcgactgat gggaaaagaa  1380
1381 gaaacaatcg agaaggtttc tcagaagatc ctgagattgt ttgaacagga ggga  1434
Warning: the change of start codon from ATG/M to GTG/V;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
711439 712875 1 Glimmer3 score 12.81 good
Genemark probabilities .91   .95 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu