LOADING...
   TM0689;TM0689
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0689    TM0689            JCSG 282559 Protein Purification 01-OCT-17

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0689
DESCRIPTIONPhosphoglycerate kinase (EC 2.7.2.3) / Triosephosphate isomerase (EC 5.3.1.1)
ORGANISMThermotoga maritima
COMMENTSubsystem: Glycolysis and gluconeogenesis

-!- CATALYTIC ACTIVITY: ATP + 3-PHOSPHO-D-GLYCERATE = ADP + 3-
PHOSPHO-D-GLYCEROYL PHOSPHATE.
-!- CATALYTIC ACTIVITY: D-GLYCERALDEHYDE 3-PHOSPHATE = GLYCERONE
PHOSPHATE.
-!- PATHWAY: SECOND PHASE OF GLYCOLYSIS; SECOND STEP.
-!- SUBUNIT: MONOMER (PGK) AND HOMOTETRAMER (PGK-TIM).
-!- SUBCELLULAR LOCATION: CYTOPLASMIC.
-!- SIMILARITY: IN THE N-TERMINAL SECTION; BELONGS TO THE
PHOSPHOGLYCERATE KINASE FAMILY.
-!- SIMILARITY: IN THE C-TERMINAL SECTION; BELONGS TO THE
TRIOSEPHOSPHATE ISOMERASE FAMILY.
--------------------------------------------------------------------------
This SWISS-PROT entry is copyright. It is produced through a collaboration
between the Swiss Institute of Bioinformatics and the EMBL outstation -
the European Bioinformatics Institute. There are no restrictions on its
use by non-profit institutions as long as its content is in no way
modified and this statement is not removed. Usage by and for commercial
entities requires a license agreement (See http://www.isb-sib.ch/announce/
or send an email to license@isb-sib.ch).
--------------------------------------------------------------------------
DR UNIPROT; PGKT_THEMA
DR SPTR; P36204 (flat text); P36204 (good view)
DR GenBank; CAA53187
DR Pfam; PF00162; PGK;
DR Pfam; PF00121; TIM;
DR Interpro; IPR001576; PGK;
DR Interpro; IPR000652; Triophos_ismrse;
DR PDB; 1B9B; Identical; 01-JAN-00; PROTEIN (TRIOSEPHOSPHATE ISOMERASE);
DR PDB; 1VPE; Identical; 17-JUN-98; PHOSPHOGLYCERATE KINASE;
DR PDB; 1PHP; Highly similar; 22-JUN-94; 3-PHOSPHOGLYCERATE KINASE;
DR PDB; 3UWD; Highly similar; 11-JAN-12; PHOSPHOGLYCERATE KINASE;
DR PDB; 1V6S; Highly similar; 23-DEC-03; PHOSPHOGLYCERATE KINASE;
DR PDB; 2IE8; Highly similar; 07-NOV-06; PHOSPHOGLYCERATE KINASE;
DR PDB; 4DG5; Highly similar; 30-JAN-13; PHOSPHOGLYCERATE KINASE;
DR PDB; 3ZLB; Highly similar; 12-FEB-14; PHOSPHOGLYCERATE KINASE;
DR FFAS; 282559; Fold and function assignment.
DR TVPC; TM0689; Homologs in PDB, JCSG and SG center.
DR OVP; TM0689; Ortholog view popup.
DR TPM; TM0689; Target PDB monitor.
DR FSS; TM0689; Target function coverage.
PROPERTY Residues: 654 aa
Molecule Weight: 71581.29 Dalton
Isoelectric Point: 5.68
Extinction Coefficient: 40910
Gravy Index: -.05
Number of Met residues: 14
Percentage of Met residues: 2.14 %
Number of Cys residues: 3
Percentage of Cys residues: 0.46 %
SEQUENCE  amino acids 654 aa
>TM0689  TM0689 phosphoglycerate kinase/triose-phosphate isomerase
MEKMTIRDVDLKGKRVIMRVDFNVPVKDGVVQDDTRIRAALPTIKYALEQGAKVILLSHL
GRPKGEPSPEFSLAPVAKRLSELLGKEVKFVPAVVGDEVKKAVEELKEGEVLLLENTRFH
PGETKNDPELAKFWASLADIHVNDAFGTAHRAHASNVGIAQFIPSVAGFLMEKEIKFLSK
VTYNPEKPYVVVLGGAKVSDKIGVITNLMEKADRILIGGAMMFTFLKALGKEVGSSRVEE
DKIDLAKELLEKAKEKGVEIVLPVDAVIAQKIEPGVEKKVVRIDDGIPEGWMGLDIGPET
IELFKQKLSDAKTVVWNGPMGVFEIDDFAEGTKQVALAIAALTEKGAITVVGGGDSAAAV
NKFGLEDKFSHVSTGGGASLEFLEGKELPGIASIADKKKITRKLILAGNWKMHKTISEAK
KFVSLLVNELHDVKEFEIVVCPPFTALSEVGEILSGRNIKLGAQNVFYEDQGAFTGEISP
LMLQEIGVEYVIVGHSERRRIFKEDDEFINRKVKAVLEKGMTPILCVGETLEEREKGLTF
CVVEKQVREGFYGLDKEEAKRVVIAYEPVWAIGTGRVATPQQAQEVHAFIRKLLSEMYDE
ETAGSIRILYGGSIKPDNFLGLIVQKDIDGGLVGGASLKESFIELARIMRGVIS

CDS  cDNA 1962 bp
   1 atggaaaaaa tgaccataag agatgttgat ctgaaaggca agagagtcat aatgagagtg    60
  61 gacttcaacg ttccagtgaa ggatggggtc gttcaggacg acacgagaat aagagccgcc   120
 121 cttccaacga taaagtacgc tcttgaacag ggtgcaaagg tgatactcct gtcccatctt   180
 181 ggaaggccca agggagaacc ttcaccagag ttcagcctcg cacctgtcgc caaaagactc   240
 241 tctgagcttc ttggaaaaga agtgaagttt gttcccgctg ttgtcggtga tgaggtgaaa   300
 301 aaggccgttg aggagctcaa agagggagag gttctcctcc ttgaaaacac cagattccac   360
 361 ccgggagaga ccaagaacga tcctgaactc gcgaagttct gggctagcct cgccgatatt   420
 421 cacgtgaacg atgccttcgg aacggcgcac agggcacacg cttccaacgt tggaatcgca   480
 481 cagtttattc ccagcgtagc gggattcctc atggaaaaag agataaagtt cctttccaag   540
 541 gtgacttata atccagaaaa accgtacgtt gtggttcttg gaggagcaaa ggtatctgac   600
 601 aaaatcggcg tcatcacgaa cctcatggag aaagccgaca gaattctcat aggtggagcc   660
 661 atgatgttca ccttcctgaa ggctcttggc aaagaggttg gatcgtccag ggttgaagaa   720
 721 gacaagatcg acctcgcaaa agaactcctc gaaaaagcga aagaaaaggg tgttgagatc   780
 781 gttcttcccg ttgatgccgt tatcgctcag aagatcgaac ccggtgtgga aaagaaggtt   840
 841 gtcagaatcg acgacgggat acccgaagga tggatgggcc tcgacatagg acccgagaca   900
 901 attgagctct tcaagcagaa gctctccgat gcaaaaaccg ttgtctggaa cgggccaatg   960
 961 ggagtcttcg aaatagacga tttcgctgaa ggcacgaagc aggtcgcact tgcgatcgca  1020
1021 gcgctcacgg aaaagggagc gatcaccgtt gtgggtggag gagacagcgc cgcggcggtg  1080
1081 aacaagttcg gtctggaaga caaattctcc cacgtttcaa cgggcggagg ggcttctctc  1140
1141 gaattccttg aaggaaaaga acttcctggt attgccagca tcgcggataa aaaaaaaata  1200
1201 actcgtaaac tgatcctcgc tgggaactgg aagatgcata aaacgatctc ggaagcgaaa  1260
1261 aagtttgtgt cgctgctcgt gaacgaactt cacgacgtga aagagttcga aatagtggtc  1320
1321 tgtcctccgt tcacagctct atctgaagtg ggggaaatac tctctggtag aaacatcaaa  1380
1381 ttgggagctc aaaacgtttt ctacgaagac cagggagcgt tcaccgggga gatttctcct  1440
1441 ctcatgctgc aagagatcgg cgttgaatac gtgatcgtgg gacattccga gagaaggcgt  1500
1501 attttcaaag aagacgacga gttcataaac aggaaagtga aagcggtgct tgaaaaaggt  1560
1561 atgactccta ttctctgcgt tggagaaaca ctcgaggaaa gagagaaagg gctcactttc  1620
1621 tgcgttgtgg aaaaacaggt gagagaaggt ttctacggtc tcgacaaaga ggaagcaaag  1680
1681 agagtggtaa tagcttacga gccagtctgg gcaatcggga caggaagggt ggcgacacca  1740
1741 cagcaggcac aggaagtaca cgcgttcata agaaagctgc tctcagagat gtacgacgag  1800
1801 gaaacagcgg gatcgataag gattctctac ggtggaagca taaagccgga caatttcctc  1860
1861 ggtctcatcg ttcagaagga tatagatggt ggtctcgttg gaggagcgag tctcaaagag  1920
1921 tctttcatag aacttgcacg aataatgaga ggtgtgattt cc  1962
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
714303 716267 3 Glimmer3 score 12.94 good
Genemark probabilities .97   .98 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu