LOADING...
   TM0706;TM0706
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0706    TM0706            JCSG 282576 Protein Purification 04-FEB-02

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0706
DESCRIPTIONHypothetical protein TM0706.
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9WZG5_THEMA
DR SPTR; Q9WZG5 (flat text); Q9WZG5 (good view)
DR GenBank; AAD35788
DR Pfam; PF02687; FtsX;
DR Interpro; IPR003838; DUF214;
DR FFAS; 282576; Fold and function assignment.
DR TVPC; TM0706; Homologs in PDB, JCSG and SG center.
DR OVP; TM0706; Ortholog view popup.
DR TPM; TM0706; Target PDB monitor.
DR FSS; TM0706; Target function coverage.
PROPERTY Residues: 852 aa
Molecule Weight: 94472.1 Dalton
Isoelectric Point: 9.01
Extinction Coefficient: 50310
Gravy Index: .52
Number of Met residues: 22
Percentage of Met residues: 2.58 %
Number of Cys residues: 2
Percentage of Cys residues: 0.23 %
SEQUENCE  amino acids 852 aa
>TM0706  TM0706 hypothetical protein
MILKIALRNFTKNLKISLVVILGLAISLSLVTGALSLSDSINVWKWERIEENFGNADAVA
EPKSPSFLFFSFATSKIDDSEIENLKKQVKGVLPVSEDSARLNSTLDVLVIATEPEYLSD
FVGESLTLNPGEALVGKSIAELMNLKVGDRITLLFSSGSKEFTVVKIGEKGFLNFKGESA
SLSGTVFINVKDFDGVFPTKCYLHYDLPVEKHEETTIETNLRVRNIKYSFLKSPINKSLA
YVTLAFSGISIFVGFLVFYMFCEDVIRDRSSTLVTLRKIGLRKMEEWGILLLEGFMYSLI
SASVGVLIGIFVGKFLLSRFQEVVDVISSSFFHFDKIGFHLSISTLLLSLGLGVLFPMFL
FFLKAREITGKPPIYREMREQLDVSWKLVIFAVLLSFVLFFSELRVFSVVLLSLIIAIKL
RNPFIMMALGTLNLGMGLFSSLNLQSEKAFIFSSLNKGSAIFFGVTLLVFSVVLLSKNVF
NNLMSRGNLSLLIGLSYVQRFPKKGITVSLTFAFLIFSVTVFNILSASADRFVQEKVKGG
LFGYNFLVLENPFRSLLAKTSLPVHEELKDPSRVYLYTLKTERGEKMIAFVDESFFRNST
LKLLRGSARSLEASDTALIGDPVDLEEITGTLKSILPLGGRKEVKFKVAGIYNKNDYLVP
IDMIAPISNVPSDVKPLSLLLGRVEESSASSVKQFYFSKFAYPFFLDEEFKKLYSGIEGL
VSVIKFIFLFGFLSASSGLLLFVLKSYFSRIKIMGTLRAVGMKINQLVASFLIEHLFFLF
GGILIGTVSGVLMGYFVSEAMSESLGTFMVSVPTASILLSLLTVIALASAVMVIPSLMMS
KLSPLEAMKEGE

CDS  cDNA 2556 bp
   1 gtgatcttga aaatcgctct gagaaacttc acaaaaaatt tgaaaatctc cctcgttgtg    60
  61 atcttaggat tggccatcag cttgtcactg gtaacgggag cgctgtccct ttcggattcg   120
 121 ataaacgtgt ggaaatggga aaggatagaa gaaaacttcg gcaacgcaga tgccgtggcg   180
 181 gagccaaaaa gcccttcctt tctctttttc tcatttgcaa cctcaaaaat cgacgattct   240
 241 gaaatagaaa acctgaaaaa acaagtgaaa ggtgttctcc cggtctcaga agacagcgcc   300
 301 aggctaaaca gcactctgga cgttctcgtg atagccacag aaccggaata cctctcagat   360
 361 ttcgttggcg agtcactgac tttgaatcca ggagaggcct tagttggaaa atccatcgca   420
 421 gaactgatga acttgaaggt gggagacaga atcacactgc ttttctcatc ggggagtaag   480
 481 gaattcaccg ttgtaaaaat cggtgagaaa ggttttttga atttcaaagg cgaatcggcg   540
 541 agcctctcgg gaactgtttt catcaacgtg aaagattttg acggagtttt tcccacgaag   600
 601 tgttaccttc actacgatct tccggttgaa aagcacgaag aaacaaccat agaaacaaat   660
 661 ctcagggtga ggaatataaa gtacagcttt ctcaaatctc cgatcaacaa atcccttgcc   720
 721 tacgtgacac tcgccttttc cggtatttcg atcttcgttg gtttcctggt tttttacatg   780
 781 ttctgtgagg acgtgataag agacaggagc tccacactcg tgactctgcg aaagatagga   840
 841 ctaagaaaga tggaagagtg gggaatactg cttttggaag gattcatgta ttctttgata   900
 901 tcggcatcag tgggtgtgtt gatcggaatt ttcgtcggaa agtttctttt gagtcgtttt   960
 961 caggaagtcg ttgatgtgat ctcatcttcg tttttccact ttgataaaat aggatttcac  1020
1021 ctttcgatca gtacacttct tctttccctt ggactcgggg ttcttttccc gatgttcctt  1080
1081 ttctttctga aagcgagaga aataacggga aaaccaccca tttacagaga aatgagagaa  1140
1141 cagctggatg tctcttggaa actcgtgatc tttgctgtgc ttttgagttt cgttcttttc  1200
1201 ttctccgaac ttcgggtgtt ttctgtggtt ttgctgtcac tgatcatcgc catcaaactc  1260
1261 agaaatccat tcatcatgat ggctctcggt actttgaatc tcggtatggg gctcttttcc  1320
1321 agtttgaatc ttcaaagtga gaaagccttc atcttttcat ctctgaacaa agggtccgcc  1380
1381 attttctttg gtgtgactct tctggttttt tcggtggttc ttctttcaaa aaacgttttc  1440
1441 aacaacctca tgtccagggg caatctttcc ctactgatag gattgtccta cgtccagcgc  1500
1501 tttccgaaga aaggcatcac agtttccctg accttcgctt tcctgatttt ctccgtcact  1560
1561 gttttcaata tactatcggc cagcgcggac cgattcgttc aagaaaaggt gaaaggagga  1620
1621 ctctttggat acaactttct ggttctggaa aatccattca ggtccttgtt ggcgaaaaca  1680
1681 tctcttcccg tccacgagga actgaaagat ccttccagag tttacctcta cactttgaaa  1740
1741 acggaaagag gagaaaaaat gatcgctttc gttgatgaat cgttctttag aaactcaacg  1800
1801 ctgaagcttc tccggggatc tgcgagatct ctggaagcct ctgataccgc cttgatagga  1860
1861 gatcccgttg atcttgaaga aataacaggt actctgaagt ccatccttcc gctcggtgga  1920
1921 agaaaagaag ttaagtttaa agtagcgggg atctacaaca agaacgatta tctggttccg  1980
1981 atcgacatga ttgcaccgat ttcaaacgtt cccagtgacg taaaacccct atccctgctc  2040
2041 cttggaagag ttgaagagag cagtgcttcc agcgtgaaac agttttactt ttcaaagttt  2100
2101 gcctatcctt tctttttgga tgaagaattc aaaaaactct acagcggaat agaggggctc  2160
2161 gtcagcgtga taaagttcat tttcctgttt ggattcttat ccgcctcctc cgggctctta  2220
2221 ctcttcgttc tgaaatcgta tttttccagg ataaagataa tgggaacact ccgtgccgtg  2280
2281 gggatgaaaa taaaccagct ggtagcttct ttcctgatag aacacctttt cttcctcttc  2340
2341 ggaggaatac tcataggtac cgtctcaggt gttctcatgg ggtatttcgt ttcagaagcg  2400
2401 atgtctgaaa gcctcggaac tttcatggtt tccgtaccaa cagcttctat ccttctttcg  2460
2461 ctcctcacag tgatcgccct tgcttcagcc gttatggtga taccgagcct catgatgtca  2520
2521 aaactctcac cactcgaagc catgaaggaa ggagag  2556
Warning: the change of start codon from ATG/M to GTG/V;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
727792 730350 -1 Glimmer3 score 10.14 poor
Genemark probabilities .82   .21 poor
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu