LOADING...
   TM0833;TM0833
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0833    TM0833            JCSG 282703 Crystal Hit 05-APR-05

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0833
DESCRIPTIONDNA gyrase subunit B (EC 5.99.1.3) (Topoisomerase II subunit B).
ORGANISMThermotoga maritima
COMMENT-!- FUNCTION: DNA GYRASE NEGATIVELY SUPERCOILS CLOSED CIRCULAR DOUBLE-
STRANDED DNA IN AN ATP-DEPENDENT MANNER AND ALSO CATALYZES THE
INTERCONVERSION OF OTHER TOPOLOGICAL ISOMERS OF DOUBLE-STRANDED
DNA RINGS, INCLUDING CATENANES AND KNOTTED RINGS.
-!- CATALYTIC ACTIVITY: ATP-DEPENDENT BREAKAGE, PASSAGE AND REJOINING
OF DOUBLE-STRANDED DNA.
-!- SUBUNIT: MADE UP OF TWO CHAINS. THE A CHAIN IS RESPONSIBLE FOR DNA
BREAKAGE AND REJOINING; THE B CHAIN CATALYZES ATP HYDROLYSIS. THE
ENZYME FORMS AN A2B2 TETRAMER.
-!- SIMILARITY: BELONGS TO THE TYPE II TOPOISOMERASE FAMILY.
--------------------------------------------------------------------------
This SWISS-PROT entry is copyright. It is produced through a collaboration
between the Swiss Institute of Bioinformatics and the EMBL outstation -
the European Bioinformatics Institute. There are no restrictions on its
use by non-profit institutions as long as its content is in no way
modified and this statement is not removed. Usage by and for commercial
entities requires a license agreement (See http://www.isb-sib.ch/announce/
or send an email to license@isb-sib.ch).
--------------------------------------------------------------------------
DR UNIPROT; GYRB_THEMA
DR SPTR; P77993 (flat text); P77993 (good view)
DR GenBank; AAC44498
DR Pfam; PF00204; DNA_gyraseB;
DR Pfam; PF00986; DNA_gyraseB_C;
DR Pfam; PF02518; HATPase_c;
DR Pfam; PF01751; Toprim;
DR Interpro; IPR003594; ATPbind_ATPase;
DR Interpro; IPR002288; DNA_gyraseB_C;
DR Interpro; IPR000565; DNA_gyrB;
DR Interpro; IPR001241; DNA_topoisoII;
DR Interpro; IPR006171; Toprim_dom;
DR PDB; 4I3H; Highly similar; 28-AUG-13; DNA (5'- D(*CP*AP*AP*AP*GP*GP*CP*GP*GP*TP*AP*AP*TP*AP*CP*GP*;
DR PDB; 4JUO; Highly similar; 28-AUG-13; DNA TOPOISOMERASE 4 SUBUNIT A;
DR KEGG; 5.99.1.3; Enzyme page
DR FFAS; 282703; Fold and function assignment.
DR TVPC; TM0833; Homologs in PDB, JCSG and SG center.
DR OVP; TM0833; Ortholog view popup.
DR TPM; TM0833; Target PDB monitor.
DR FSS; TM0833; Target function coverage.
PROPERTY Residues: 636 aa
Molecule Weight: 72424 Dalton
Isoelectric Point: 6.41
Extinction Coefficient: 49280
Gravy Index: -.5
Number of Met residues: 12
Percentage of Met residues: 1.89 %
Number of Cys residues: 2
Percentage of Cys residues: 0.31 %
SEQUENCE  amino acids 636 aa
>TM0833  TM0833 DNA gyrase, subunit B (gyrB)
MEKYSAESIKVLKGLEPVRMRPGMYIGSTGKRGLHHLVYEVVDNSVDEALAGYCDWIRVT
LHEDGSVEVEDNGRGIPVDIHPEEGRSALEVVFTVLHAGGKFSKDSYKISGGLHGVGVSV
VNALSEWLEVRVHRDGKIYRQRYERGKPVTPVEVIGETDKHGTIVRFKPDPLIFSETEFD
PDILEHRLREIAFLVPGLKIEFEDRINGEKKTFKFDGGIVEYVKYLNRGKKALHDVIHIK
RTEKVKTKNGEDEVIVEIAFQYTDSYSEDIVSFANTIKTVDGGTHVTAFKSTLTRLMNEY
GKKHNFLKKDDSFQGEDVREGLTAVISVYVKNPEFEGQTKSKLGNEEVKEAVTKAMREEL
KKIFDANPELVKTILSKIMSTKQAREAAKRAREMVRRKNVLQNTTLPGKLADCSSTHREK
TELFIVEGDSAGGSAKQARDREFQAVLPIRGKILNVEKSSLDRLLKNEQISDIIVAVGTG
IGDDFDESKLRYGRIIIMTDADIDGAHIRTLLLTLFYRYMRPLIEQGRVYIALPPLYRIK
AGREEFYVYSDQELAEYKEKLQGKRIEIQRYKGLGEMNPEQLWETTMNPETRKIIRVTIE
DAEEADRLFEILMGNDPSSRREFIERHALKVKELDI

CDS  cDNA 1908 bp
   1 atggaaaagt actccgctga aagtataaag gttttaaaag gactggaacc tgtccgaatg    60
  61 cgacccggaa tgtacatagg atccacgggc aaacgtggat tgcatcacct cgtgtacgaa   120
 121 gtggttgaca acagtgttga tgaggcactc gctggatact gcgactggat acgtgtgact   180
 181 ctccatgaag atggaagtgt ggaagtcgag gacaacggaa ggggaatccc cgttgacata   240
 241 catccagaag agggaagaag cgctctggaa gtggttttca cagttcttca tgcgggcgga   300
 301 aaattctcca aggattccta caagataagc ggtggcctgc acggtgttgg tgtatcggtg   360
 361 gtgaacgctc tttcggagtg gctggaagtg cgggtacatc gtgacgggaa gatctacaga   420
 421 caaagatacg aaaggggtaa accggtcaca cctgtggaag tgataggaga aaccgataag   480
 481 cacggcacga tcgttcgatt caaacccgat cctctcatat tttcggagac agagttcgat   540
 541 cccgacatac tcgaacacag attgagagag atagctttcc tagtaccagg actcaaaata   600
 601 gaattcgaag acagaataaa cggagagaag aaaaccttca aattcgacgg aggcatagtg   660
 661 gagtatgtga agtatttgaa ccgtgggaaa aaagctctac acgatgtgat acacataaag   720
 721 agaacggaaa aagtgaaaac aaaaaatggt gaagacgaag tgatagtgga gatcgccttt   780
 781 caatacactg attcgtattc tgaagatatc gtgtcttttg caaacaccat aaaaactgtc   840
 841 gatggtggaa ctcatgttac agcctttaag agcaccctca caagactcat gaacgagtat   900
 901 gggaaaaaac ataattttct caagaaagac gattccttcc agggtgagga tgttagagaa   960
 961 ggcctcacgg cggttatcag tgtttacgtg aagaaccccg aattcgaagg gcaaacaaag  1020
1021 tcaaaactcg gcaacgaaga agtcaaggaa gcggtaacca aggctatgag agaagagctg  1080
1081 aaaaaaatat tcgacgcgaa tcccgagctc gtgaaaacaa ttctttcaaa gatcatgagc  1140
1141 accaaacagg caagagaagc ggcaaagaga gctcgagaaa tggtgagaag gaaaaacgtt  1200
1201 cttcaaaaca caacacttcc cggaaaactg gcagactgta gttccacaca tagagagaaa  1260
1261 acggagcttt tcatcgtgga aggtgactct gccgggggat cggcaaaaca ggccagagac  1320
1321 agagaatttc aggctgttct tcccataaga ggaaagattt tgaacgtgga aaaatcatct  1380
1381 ctcgatagat tactgaaaaa cgagcagatc agtgacataa ttgttgcagt gggaacgggc  1440
1441 ataggagatg atttcgacga aagcaagctc agatacggta ggattatcat catgaccgac  1500
1501 gccgatatag acggtgcaca cataagaact ctccttctga cactcttcta tagatacatg  1560
1561 agacccctca tcgaacaggg cagggtatac atagcactcc cacctctcta caggatcaaa  1620
1621 gctggaagag aagagttcta cgtttacagt gaccaggagc tggcggaata caaagagaaa  1680
1681 ctccagggaa aaaggatcga aattcaacgg tacaaaggac ttggcgagat gaatcctgag  1740
1741 cagctctggg aaacaacgat gaatccagaa acgagaaaaa tcataagggt aactatagaa  1800
1801 gatgccgaag aagcggatag actctttgaa attctcatgg gtaacgatcc atccagtaga  1860
1861 agggagttca tagaaaggca cgctctgaaa gtgaaagaac tggatatc  1908
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
857660 859570 2 Glimmer3 score 10 poor
Genemark probabilities .93   .96 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu