LOADING...
   TM0928;TM0928
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0928    TM0928            JCSG 282797 Screening 03-MAY-04

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0928
DESCRIPTIONHypothetical protein TM0928.
ORGANISMThermotoga maritima
COMMENT-!- CAUTION: REF.1 SEQUENCE DIFFERS FROM THAT SHOWN DUE TO TWO
FRAMESHIFTS, ONE IN POSITIONS 229-246; THE OTHER ONE FUSES
TOGETHER TM0929 AND TM0928.
--------------------------------------------------------------------------
This SWISS-PROT entry is copyright. It is produced through a collaboration
between the Swiss Institute of Bioinformatics and the EMBL outstation -
the European Bioinformatics Institute. There are no restrictions on its
use by non-profit institutions as long as its content is in no way
modified and this statement is not removed. Usage by and for commercial
entities requires a license agreement (See http://www.isb-sib.ch/announce/
or send an email to license@isb-sib.ch).
--------------------------------------------------------------------------
DR UNIPROT; Y928_THEMA
DR SPTR; P56728 (flat text); P56728 (good view)
DR GenBank; AAA65436
DR FFAS; 282797; Fold and function assignment.
DR TVPC; TM0928; Homologs in PDB, JCSG and SG center.
DR OVP; TM0928; Ortholog view popup.
DR TPM; TM0928; Target PDB monitor.
DR FSS; TM0928; Target function coverage.
PROPERTY Residues: 246 aa
Molecule Weight: 29363.9 Dalton
Isoelectric Point: 6.62
Extinction Coefficient: 19940
Gravy Index: -.32
Number of Met residues: 13
Percentage of Met residues: 5.28 %
Number of Cys residues: 1
Percentage of Cys residues: 0.41 %
SEQUENCE  amino acids 246 aa
>TM0928  TM0928 hypothetical protein
MKRELELLLKETSVHNPLKDYESKLDNVHLHTFVLRIKRHRFPSLFLMIDTSDRRLLNLS
VEDPFDREPCIYRVEADVPESMVSFYTKLFEKVDSVSAGIFRMPLKVKVLRSAGNESWLQ
KIFLQEKVKNMEFFLFQNRVSDENLEKMMKLLKSRLKIVLRNEGIDVFLETPEWVDKEHI
SLLHEMGVVLRKKKGIQPAQNPMEQAFLTLRVGYDQFFEEDFDMEYFAKDFMEKLKRMYE
VLVSML

CDS  cDNA 738 bp
   1 atgaagaggg aattggaact tcttctgaag gaaacatcgg tacacaatcc tcttaaagac    60
  61 tacgagagta agcttgataa cgtgcatctt cacacgtttg tactcagaat aaagagacat   120
 121 cgtttcccat ccctgtttct catgattgac acatccgaca gaagactgct gaatctctcc   180
 181 gttgaagatc ccttcgatag ggaaccgtgt atatacaggg tagaagcaga tgttccggaa   240
 241 tccatggtct ccttctacac gaagctgttc gaaaaggtgg attcggtctc cgcgggaata   300
 301 ttcaggatgc cgttgaaggt gaaggtttta aggtccgccg gaaatgaaag ctggcttcaa   360
 361 aaaatattcc ttcaagaaaa agtgaaaaac atggagttct ttctcttcca aaacagggta   420
 421 tctgatgaga atctggaaaa gatgatgaaa cttttaaaat cgcgactgaa gatcgttctg   480
 481 agaaacgagg gaatcgatgt gttccttgaa actccagagt gggtagataa agaacacatc   540
 541 tcgctgctcc acgaaatggg tgttgttttg agaaagaaaa agggcattca acctgcgcag   600
 601 aatcctatgg aacaggcctt tctcacactc agagtaggat acgatcagtt cttcgaagaa   660
 661 gactttgaca tggaatattt tgcgaaagat tttatggaaa aattgaaaag aatgtatgag   720
 721 gtactcgttt caatgtta   738
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
945919 946659 -1 Glimmer3 score 9.01 poor
Genemark probabilities .81   .64 poor
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu