LOADING...
   TM1031;TM1031
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1031    TM1031            JCSG 282898 Crystal Hit 01-NOV-06

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1031
DESCRIPTIONGlutaredoxin.
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9X0C1_THEMA
DR SPTR; Q9X0C1 (flat text); Q9X0C1 (good view)
DR GenBank; AAD36108
DR Pfam; PF00462; Glutaredoxin;
DR Interpro; IPR002109; Glutaredoxin;
DR PDB; 1FOV; Highly similar; 26-OCT-00; GLUTAREDOXIN 3;
DR PDB; 1ILB; Highly similar; 16-MAY-01; GLUTAREDOXIN 3;
DR PDB; 4TR0; Highly similar; 01-OCT-14; GLUTAREDOXIN 3;
DR PDB; 3GRX; Highly similar; 30-MAR-99; GLUTAREDOXIN 3;
DR PDB; 2KLX; Highly similar; 28-JUL-09; GLUTAREDOXIN;
DR PDB; 4TR1; Highly similar; 01-OCT-14; GLUTAREDOXIN 3;
DR PDB; 2KHP; Highly similar; 05-MAY-09; GLUTAREDOXIN;
DR PDB; 3ZIJ; Highly similar; 23-JAN-13; THIOREDOXIN;
DR FFAS; 282898; Fold and function assignment.
DR TVPC; TM1031; Homologs in PDB, JCSG and SG center.
DR OVP; TM1031; Ortholog view popup.
DR TPM; TM1031; Target PDB monitor.
DR FSS; TM1031; Target function coverage.
PROPERTY Residues: 80 aa
Molecule Weight: 9126.49 Dalton
Isoelectric Point: 9.74
Extinction Coefficient: 4470
Gravy Index: -.27
Number of Met residues: 3
Percentage of Met residues: 3.75 %
Number of Cys residues: 2
Percentage of Cys residues: 2.50 %
SEQUENCE  amino acids 80 aa
>TM1031  TM1031 glutaredoxin
MQHLKIKIYTTPTCPYCRKAKEYFRSLGLKFKEVDVTKNPREAELMVKKTGQMGVPVIEI
GNKIVIGFDKAKIDRLLGIS

CDS  cDNA 240 bp
   1 atgcagcacc tgaaaatcaa aatctacaca actcccacct gcccgtactg caggaaggcg    60
  61 aaggaatact tcagatcgct ggggctcaag ttcaaagaag tcgatgtaac aaaaaatcca   120
 121 agagaagccg agctcatggt gaagaagacc ggacaaatgg gagttcccgt gatagagatc   180
 181 ggcaacaaga tagtcatcgg attcgacaag gcaaaaatcg acagactcct tggaatatcg   240
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1048535 1048777 -2 Glimmer3 score 11.71 poor
Genemark probabilities .81   .35 poor
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu