LOADING...
   TM1084;TM1084
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1084    TM1084            JCSG 282951 Protein Purification 04-FEB-02

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1084
DESCRIPTIONDNA gyrase subunit A (EC 5.99.1.3) (Topoisomerase II subunit A).
ORGANISMThermotoga maritima
COMMENT-!- FUNCTION: DNA GYRASE NEGATIVELY SUPERCOILS CLOSED CIRCULAR DOUBLE-
STRANDED DNA IN AN ATP-DEPENDENT MANNER AND ALSO CATALYZES THE
INTERCONVERSION OF OTHER TOPOLOGICAL ISOMERS OF DOUBLE-STRANDED
DNA RINGS, INCLUDING CATENANES AND KNOTTED RINGS.
-!- CATALYTIC ACTIVITY: ATP-DEPENDENT BREAKAGE, PASSAGE AND REJOINING
OF DOUBLE-STRANDED DNA.
-!- SUBUNIT: MADE UP OF TWO CHAINS. THE A CHAIN IS RESPONSIBLE FOR DNA
BREAKAGE AND REJOINING; THE B CHAIN CATALYZES ATP HYDROLYSIS. THE
ENZYME FORMS AN A2B2 TETRAMER.
--------------------------------------------------------------------------
This SWISS-PROT entry is copyright. It is produced through a collaboration
between the Swiss Institute of Bioinformatics and the EMBL outstation -
the European Bioinformatics Institute. There are no restrictions on its
use by non-profit institutions as long as its content is in no way
modified and this statement is not removed. Usage by and for commercial
entities requires a license agreement (See http://www.isb-sib.ch/announce/
or send an email to license@isb-sib.ch).
--------------------------------------------------------------------------
DR UNIPROT; GYRA_THEMA
DR SPTR; O33926 (flat text); O33926 (good view)
DR GenBank; AAB87144
DR Pfam; PF00521; DNA_topoisoIV;
DR Pfam; PF03989; DNA_gyraseA_C;
DR Interpro; IPR005743; DNA_gyrA;
DR Interpro; IPR006691; DNA_gyraseA_C;
DR Interpro; IPR002205; DNA_topoisoIV;
DR PDB; 4DDQ; Highly similar; 13-FEB-13; DNA GYRASE SUBUNIT A;
DR PDB; 2XCO; Highly similar; 04-AUG-10; DNA GYRASE SUBUNIT B, DNA GYRASE SUBUNIT A;
DR PDB; 2XCQ; Highly similar; 04-AUG-10; DNA GYRASE SUBUNIT B, DNA GYRASE SUBUNIT A;
DR PDB; 2XCR; Highly similar; 04-AUG-10; DNA GYRASE SUBUNIT B, DNA GYRASE SUBUNIT A;
DR PDB; 2XCS; Highly similar; 04-AUG-10; DNA GYRASE SUBUNIT B, DNA GYRASE SUBUNIT A;
DR PDB; 2XCT; Highly similar; 25-AUG-10; DNA GYRASE SUBUNIT B, DNA GYRASE SUBUNIT A;
DR PDB; 4PLB; Highly similar; 18-JUN-14; DNA (5'- D(P*AP*GP*CP*CP*GP*TP*AP*GP*GP*GP*CP*CP*CP*TP*AP*CP;
DR PDB; 5BS3; Highly similar; 17-JUN-15; DNA GYRASE SUBUNIT A AND B;
DR KEGG; 5.99.1.3; Enzyme page
DR FFAS; 282951; Fold and function assignment.
DR TVPC; TM1084; Homologs in PDB, JCSG and SG center.
DR OVP; TM1084; Ortholog view popup.
DR TPM; TM1084; Target PDB monitor.
DR FSS; TM1084; Target function coverage.
PROPERTY Residues: 804 aa
Molecule Weight: 90443.53 Dalton
Isoelectric Point: 7.7
Extinction Coefficient: 40230
Gravy Index: -.33
Number of Met residues: 23
Percentage of Met residues: 2.86 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 804 aa
>TM1084  TM1084 DNA gyrase, subunit A (gyrA)
MPEILINKPVEDELVESYLLYSMSVIVGRAIPDVRDGLKPVQRRILYGMYELGLKHNSPT
KKSARIVGEVMGKYHPHGDAPVYDALVRMAQPFTMRYPLIEGQGNFGSIDRDPPAAMRYT
EARLTRLAEEMLEDIEKNTVNMIDNFDGTLKEPEVLPSKVPNLIINGASGIAVGMATNIP
PHNLSETVDALIYLIDHPEATVEELMQFIKGPDFPTGAVVVNASELKKVYEEGRGRIIVR
GKVHVEDGKRVKRIVITEIPYGVSKAGLIEQIAKIAKDDESLPIRNIRDESDKRGMRIVI
EIPKDANEEVIINNLYKRTALQDYFNVQMLVIDKHKRPRLMNLKGLMEAFLEHRFEVIRR
RARYEYEQYTRRAHVVEGLLKAARAIGVVVDIVRNSKDVESARQSLMETLEITEEQAKAI
LDMRLSRLTSLEIENLQNEYSDLVRKISEVKEILEKDEKVKEIMKKEFLYLKQQYGDPRR
TEVTDQSIEYNEEELIVEEDVVITLSHKGYLKSTPLNSYRSQKRGGKGITVSKLSEDDEV
EFVVVAKNTSSTLFITNLGRAYVLKNYQLETTGRNTRGRHITAFLNLEDTEKIVALASLN
GEGRDLVIATKSGKIKRTALKEFENATSNRGVRAIKIEPGDEIVSARVVNSEKETLIVAT
KMGMAIRFPVSDVRRMGRNAAGVQAIKLQPGDEVVSVDVIPPGEEGEILTVTEKGFGKRT
PVQLYRIQRRGGTGLRNISDVNKTGYVVAVRYVRGDEEIVVVTRNGMMIRFPVSEIGVIG
RVTKGVKLIELGDDTISKVAVVKD

CDS  cDNA 2412 bp
   1 atgccagaga tcctgataaa caaacccgta gaggatgagc ttgttgagtc ttatcttctg    60
  61 tactcgatga gcgttatagt gggaagggcc attccggatg ttcgggacgg cctcaaaccc   120
 121 gttcagagga gaattctcta tggaatgtac gaactcggcc tcaagcacaa ctcacccaca   180
 181 aagaagagtg cgagaatcgt cggtgaagtg atgggtaagt accatcctca cggcgacgca   240
 241 cccgtgtatg atgccctcgt gaggatggct caaccgttca cgatgaggta tccactcata   300
 301 gagggtcagg gaaacttcgg ttccatagac agagaccctc cagccgcgat gaggtacacg   360
 361 gaagcgagac tcacgaggct cgcagaagaa atgctcgaag acatagaaaa gaacacggtg   420
 421 aacatgatcg acaatttcga tggcacgctg aaggagcctg aagtcctccc atccaaagtg   480
 481 ccaaatctca taataaacgg tgcctccggt atagcggtgg gaatggccac gaacatacct   540
 541 ccacacaatc tctccgagac cgtggatgcc ctgatttatt tgatcgacca tccagaagcc   600
 601 acggttgaag aactcatgca gttcataaag gggccggatt tccccacagg agccgtggta   660
 661 gtgaacgctt ctgagttgaa gaaggtttac gaagagggaa gaggcaggat catcgtcaga   720
 721 gggaaggtgc acgtcgagga tggaaagaga gtgaagcgaa tcgtcatcac ggagattccg   780
 781 tacggagtca gtaaagcggg tctcatagag caaatagcga agattgcaaa agacgacgaa   840
 841 tcactcccaa tcaggaacat aagagatgaa tctgacaaac gcggaatgag aatagtcata   900
 901 gaaattccaa aagacgcaaa cgaagaggtc ataataaaca atctctacaa gagaaccgct   960
 961 cttcaggatt acttcaacgt tcagatgctg gtcatagaca aacacaaaag gcccaggttg  1020
1021 atgaatctga aaggattgat ggaagctttc cttgagcacc gctttgaagt catcagaaga  1080
1081 agagcaaggt acgaatacga gcagtacaca aggagggcac acgttgtcga gggtctcctg  1140
1141 aaagcggcaa gagcgatagg tgttgttgtg gacatcgtga ggaacagcaa agatgtggaa  1200
1201 agtgcgaggc aatcgctcat ggaaacactc gagatcaccg aagaacaggc aaaagccatt  1260
1261 ctcgacatga gactttcgag gctgacttcc ctcgaaatag agaaccttca aaacgaatac  1320
1321 tccgatctgg tcaggaagat ctcagaagtg aaggaaatac tcgagaagga cgaaaaagta  1380
1381 aaggagataa tgaaaaaaga attcctctac ctgaagcagc aatacggaga tcccagaaga  1440
1441 acagaagtaa cagatcaaag tatcgaatac aacgaagaag aactcattgt cgaagaggac  1500
1501 gtggtgatca cactgagtca taagggttat ctgaagagca caccgctgaa cagctacaga  1560
1561 tcgcagaagc gtggaggtaa aggtatcacc gtctcgaaac tctctgaaga tgatgaggtc  1620
1621 gagttcgttg tggtcgcgaa gaacacctca tcgaccctgt ttataacgaa cctcgggcgg  1680
1681 gcgtacgttc tcaagaatta tcagctggaa actaccggaa gaaacacgag aggaagacac  1740
1741 atcaccgcgt ttctgaatct cgaagacaca gaaaagatcg tggcactcgc ttctctgaac  1800
1801 ggtgaaggaa gggatcttgt gatcgctacg aagtccggga agatcaaaag gaccgccctc  1860
1861 aaagagtttg aaaacgccac cagcaatcgc ggtgtcagag ccataaagat agaacctgga  1920
1921 gatgagatcg tcagcgccag ggttgttaac agcgaaaaag aaacactcat agtggcaacg  1980
1981 aagatgggta tggccatcag atttccggtg agtgatgttc gcagaatggg aagaaatgcg  2040
2041 gccggagttc aggcgataaa gcttcagcca ggagacgaag tggtgagtgt ggacgtgata  2100
2101 cctccaggtg aggaaggaga gattctcacc gtgacagaga agggattcgg caagagaaca  2160
2161 cccgttcagc tgtacaggat tcaaagaagg ggaggaacgg gtctcagaaa catctccgat  2220
2221 gtgaacaaaa cgggatacgt agtagctgtg aggtacgtga ggggcgacga agagatagtg  2280
2281 gtggtcacaa gaaacggtat gatgatcaga tttcccgtgt ctgaaatcgg tgtcatcggt  2340
2341 cgtgtaacga aaggtgtgaa actcatcgaa cttggagacg ataccatatc gaaggtggcg  2400
2401 gtggtgaaag at  2412
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1097879 1100293 -2 Glimmer3 score 14.77 good
Genemark probabilities .96   .62 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu