LOADING...
   TM1341;TM1341
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1341    TM1341            JCSG 283203 Protein Purification 01-DEC-19

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1341
DESCRIPTIONHypothetical protein TM1341.
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9X163_THEMA
DR SPTR; Q9X163 (flat text); Q9X163 (good view)
DR GenBank; AAD36413
DR FFAS; 283203; Fold and function assignment.
DR TVPC; TM1341; Homologs in PDB, JCSG and SG center.
DR OVP; TM1341; Ortholog view popup.
DR TPM; TM1341; Target PDB monitor.
DR FSS; TM1341; Target function coverage.
PROPERTY Residues: 157 aa
Molecule Weight: 18069.33 Dalton
Isoelectric Point: 9.52
Extinction Coefficient: 64400
Gravy Index: .28
Number of Met residues: 2
Percentage of Met residues: 1.27 %
Number of Cys residues: 1
Percentage of Cys residues: 0.64 %
SEQUENCE  amino acids 157 aa
>TM1341  TM1341 hypothetical protein
MSGVKTYDPTSWRPKHLDLLLSAVIAFSLPAVAGWLYDLSGVLIPMLIYYSLAWGLVKLR
RGVVGYGTPFPKKPPKWFYVNVLVILTALFFAYQARIRVEEVDRFGVLLTALLWAPVNAS
TEQILWLYLFDSWDLYPEKPRLRYRLQAWCSSPPSWG

CDS  cDNA 471 bp
   1 atgtccggag tgaaaaccta tgacccgact tcatggagac caaagcacct tgacctcctg    60
  61 ctttcagctg taatagcctt ctctctccct gctgtggcgg gatggctcta tgatctgagc   120
 121 ggggtcctca ttcccatgct tatctactac tccctcgcct ggggccttgt gaagctgaga   180
 181 agaggcgttg taggctatgg aacacccttc ccgaaaaagc ctcccaagtg gttctatgtg   240
 241 aacgtccttg taatactcac ggccctattc tttgcctacc aggcacggat tagagttgag   300
 301 gaagttgacc ggtttggtgt tctccttacg gcacttttgt gggctccggt gaatgcttcg   360
 361 accgaacaga tactctggct ctacctgttt gattcatggg acctgtaccc tgaaaaaccc   420
 421 aggctcagat atcgcttgca ggcctggtgt tcttcgccgc cttcgtgggg c   471
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1360924 1361397 1 Glimmer3 score 2.04 poor
Genemark probabilities .67   .76 poor
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu