LOADING...
   TM1351;TM1351
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1351    TM1351            JCSG 283212 PDB Deposition 06-DEC-06              PDB id: 2o5r

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1351
DESCRIPTIONGlutamyl-tRNA synthetase 1 (EC 6.1.1.17) (Glutamate--tRNA ligase 1) (GluRS 1).
ORGANISMThermotoga maritima
COMMENTSubsystem: tRNA aminoacylation.
The aminoacyl-tRNA synthetases (EC 6.1.1. ) catalyse the attachment of an amino acid to its cognate transfer RNA molecule in a highly specific two-step reaction. These proteins differ widely in size and oligomeric state, and have limited sequence homology . The 20 aminoacyl-tRNA synthetases are divided into two classes, I and II.
Glutamyl-tRNA synthetase (EC:6.1.1.17) is a class Ic synthetase and shows several similarities with glutaminyl-tRNA synthetase concerning structure and catalytic properties. It is an alpha2 dimer.
Archaea, cellular organelles, and some bacteria lack GlnRS. In these cases, the "non-descriminating" form of GluRS aminoacylates both tRNA(Glu) and tRNA(Gln) with Glu, which is converted to Gln when appropriate by a transamidation enzyme.
-----------------------------------------------------------------------------
-!- CATALYTIC ACTIVITY: ATP + L-GLUTAMATE + TRNA(GLU) = AMP +
DIPHOSPHATE + L-GLUTAMYL-TRNA(GLU).
-!- SUBUNIT: MONOMER (BY SIMILARITY).
-!- SUBCELLULAR LOCATION: CYTOPLASMIC.
-!- SIMILARITY: BELONGS TO CLASS-I AMINOACYL-TRNA SYNTHETASE FAMILY.
--------------------------------------------------------------------------
This SWISS-PROT entry is copyright. It is produced through a collaboration
between the Swiss Institute of Bioinformatics and the EMBL outstation -
the European Bioinformatics Institute. There are no restrictions on its
use by non-profit institutions as long as its content is in no way
modified and this statement is not removed. Usage by and for commercial
entities requires a license agreement (See http://www.isb-sib.ch/announce/
or send an email to license@isb-sib.ch).
--------------------------------------------------------------------------
DR UNIPROT; SYE1_THEMA
DR SPTR; Q9X172 (flat text); Q9X172 (good view)
DR GenBank; AAD36422
DR Pfam; PF00749; tRNA-synt_1c;
DR Interpro; IPR004527; GltX_bact;
DR Interpro; IPR000924; Glu_tRNA-synt_1c;
DR Interpro; IPR001412; tRNA-synt_I;
DR PDB; 2O5R; Identical; 19-DEC-06; GLUTAMYL-TRNA SYNTHETASE 1;
DR PDB; 3AKZ; Highly similar; 29-SEP-10; GLUTAMYL-TRNA SYNTHETASE 2;
DR PDB; 3AFH; Highly similar; 30-JUN-10; GLUTAMYL-TRNA SYNTHETASE 2;
DR PDB; 1J09; Highly similar; 25-FEB-03; GLUTAMYL-TRNA SYNTHETASE;
DR PDB; 1N75; Highly similar; 25-FEB-03; GLUTAMYL-TRNA SYNTHETASE;
DR PDB; 1N77; Highly similar; 25-FEB-03; GLUTAMYL-TRNA SYNTHETASE;
DR PDB; 1N78; Highly similar; 25-FEB-03; GLUTAMYL-TRNA SYNTHETASE;
DR PDB; 2CUZ; Highly similar; 05-SEP-06; GLUTAMYL-TRNA SYNTHETASE;
DR KEGG; 6.1.1.17; Enzyme page
DR FFAS; 283212; Fold and function assignment.
DR TVPC; TM1351; Homologs in PDB, JCSG and SG center.
DR OVP; TM1351; Ortholog view popup.
DR TPM; TM1351; Target PDB monitor.
DR FSS; TM1351; Target function coverage.
PROPERTY Residues: 469 aa
Molecule Weight: 54604.11 Dalton
Isoelectric Point: 5.64
Extinction Coefficient: 54320
Gravy Index: -.45
Number of Met residues: 14
Percentage of Met residues: 2.99 %
Number of Cys residues: 1
Percentage of Cys residues: 0.21 %
SEQUENCE  amino acids 469 aa
>TM1351  TM1351 glutamyl-tRNA synthetase (gltX-1)
MVRVRFAPSPTGFLHVGGARTALFNFLFARKEKGKFILRIEDTDLERSEREYEEKLMESL
RWLGLLWDEGPDVGGDHGPYRQSERVEIYREHAERLVKEGKAYYVYAYPEEIEEMREKLL
SEGKAPHYSQEMFEKFDTPERRREYEEKGLRPAVFFKMPRKDYVLNDVVKGEVVFKTGAI
GDFVIMRSNGLPTYNFACVVDDMLMEITHVIRGDDHLSNTLRQLALYEAFEKAPPVFAHV
STILGPDGKKLSKRHGATSVEAFRDMGYLPEALVNYLALLGWSHPEGKELLTLEELISSF
SLDRLSPNPAIFDPQKLKWMNGYYLRNMPIEKLAELAKPFFEKAGIKIIDEEYFKKVLEI
TKERVEVLSEFPEESRFFFEDPAPVEIPEEMKEVFSQLKEELQNVRWTMEEITPVFKKVL
KQHGVKPKEFYMTLRRVLTGREEGPELVNIIPLLGKEIFLRRIERSLGG

CDS  cDNA 1407 bp
   1 ttggtaaggg tgagattcgc accgagcccc actggctttc tccacgttgg aggagctcga    60
  61 accgctctgt tcaactttct tttcgcacgg aaagaaaaag gaaagttcat cctcagaata   120
 121 gaagacaccg atttggagag atctgagagg gagtacgaag agaagctcat ggaatctctc   180
 181 aggtggcttg gtcttctgtg ggatgaggga ccggacgtgg gaggagacca cggtccatac   240
 241 aggcagagcg agagagtgga gatatacaga gaacacgctg aaaggcttgt aaaggagggg   300
 301 aaggcctatt acgtttacgc ttaccctgaa gagatcgaag agatgaggga gaaactcctc   360
 361 tctgaaggaa aggcaccaca ctactcccag gagatgttcg aaaagtttga tactcccgag   420
 421 agaagaaggg aatacgaaga aaagggtttg aggccggctg tgtttttcaa gatgcccaga   480
 481 aaagactatg tgttgaacga tgtggtgaaa ggtgaagttg tgttcaagac aggagcaatt   540
 541 ggggattttg tgataatgag aagcaacggt cttcccacct acaatttcgc ctgtgtggtg   600
 601 gatgacatgc tcatggaaat aacacacgtt atccgtggag acgaccatct ctcaaataca   660
 661 ctgagacagc tcgctctcta tgaagcgttt gaaaaggctc cccccgtttt tgcgcacgtt   720
 721 tccaccatac tgggacccga tggaaaaaaa ctgagcaaga gacatggagc cacttctgtg   780
 781 gaagcgttca gagacatggg atatcttccg gaggcgcttg tcaactatct ggcacttctt   840
 841 ggatggtctc acccagaggg taaagaactc ctcactctcg aagaattgat ttcttcgttt   900
 901 tctctggaca ggctcagccc gaaccctgcg attttcgacc cacagaagtt gaaatggatg   960
 961 aacggttact atttgaggaa catgccgatt gagaagctcg cagaactggc aaagccgttc  1020
1021 tttgagaaag ccgggataaa aataatcgac gaggagtact ttaaaaaggt attggagatc  1080
1081 acaaaagaga gagtagaggt gctttcagaa tttcctgaag agtcccgctt cttctttgaa  1140
1141 gatccagcac ctgttgaaat accagaagaa atgaaagaag tgttttcaca gctcaaagaa  1200
1201 gagctccaga acgttcggtg gaccatggaa gaaatcacac ctgtcttcaa gaaggtactg  1260
1261 aaacaacacg gtgtaaagcc caaagaattc tatatgacgt tgagaagagt tctgactggt  1320
1321 agagaagaag gtcctgaact cgtcaacatt attcctcttc ttggaaagga gatctttttg  1380
1381 agaagaatag aaagatctct gggggga  1407
Warning: the change of start codon from ATG/M to TTG/L;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1370561 1371970 -2 Glimmer3 score 12.62 good
Genemark probabilities -   - -
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu