LOADING...
   TM1379;TM1379
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1379    TM1379            JCSG 283240 Screening 09-JUN-06

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1379
DESCRIPTIONSeryl-tRNA synthetase (EC 6.1.1.11) (Serine--tRNA ligase) (SerRS).
ORGANISMThermotoga maritima
COMMENT-!- CATALYTIC ACTIVITY: ATP + L-SERINE + TRNA(SER) = AMP + DIPHOSPHATE
+ L-SERYL-TRNA(SER).
-!- SUBUNIT: HOMODIMER (BY SIMILARITY).
-!- SUBCELLULAR LOCATION: CYTOPLASMIC.
-!- SIMILARITY: BELONGS TO CLASS-II AMINOACYL-TRNA SYNTHETASE FAMILY.
--------------------------------------------------------------------------
This SWISS-PROT entry is copyright. It is produced through a collaboration
between the Swiss Institute of Bioinformatics and the EMBL outstation -
the European Bioinformatics Institute. There are no restrictions on its
use by non-profit institutions as long as its content is in no way
modified and this statement is not removed. Usage by and for commercial
entities requires a license agreement (See http://www.isb-sib.ch/announce/
or send an email to license@isb-sib.ch).
--------------------------------------------------------------------------
DR UNIPROT; SYS_THEMA
DR SPTR; Q9X199 (flat text); Q9X199 (good view)
DR GenBank; AAD36449
DR Pfam; PF00587; tRNA-synt_2b;
DR Pfam; PF02403; Seryl_tRNA_N;
DR Interpro; IPR002314; tRNA-synt_2b;
DR Interpro; IPR002317; tRNA-synt_ser;
DR Interpro; IPR006195; tRNA_ligase_II;
DR PDB; 2DQ3; Highly similar; 05-JUN-07; SERYL-TRNA SYNTHETASE;
DR PDB; 2DQ0; Highly similar; 05-JUN-07; SERYL-TRNA SYNTHETASE;
DR PDB; 2ZR2; Highly similar; 09-SEP-08; SERYL-TRNA SYNTHETASE;
DR PDB; 2ZR3; Highly similar; 09-SEP-08; SERYL-TRNA SYNTHETASE;
DR PDB; 1SRY; Highly similar; 31-JAN-94; SERYL-TRNA SYNTHETASE;
DR PDB; 1SER; Highly similar; 30-APR-94; PROTEIN (SERYL-TRNA SYNTHETASE (E.C.6.1.1.11));
DR PDB; 1SES; Highly similar; 31-JUL-94; SERYL-TRNA SYNTHETASE;
DR PDB; 1SET; Highly similar; 31-JUL-94; SERYL-TRNA SYNTHETASE;
DR KEGG; 6.1.1.11; Enzyme page
DR FFAS; 283240; Fold and function assignment.
DR TVPC; TM1379; Homologs in PDB, JCSG and SG center.
DR OVP; TM1379; Ortholog view popup.
DR TPM; TM1379; Target PDB monitor.
DR FSS; TM1379; Target function coverage.
PROPERTY Residues: 425 aa
Molecule Weight: 48889.28 Dalton
Isoelectric Point: 5.64
Extinction Coefficient: 60850
Gravy Index: -.5
Number of Met residues: 7
Percentage of Met residues: 1.65 %
Number of Cys residues: 3
Percentage of Cys residues: 0.71 %
SEQUENCE  amino acids 425 aa
>TM1379  TM1379 seryl-tRNA synthetase (serS)
MIDIKLIRQNPDFVKEALRKRGEDPAIIDEILKIDADWRATITKTNELRSRRNEISKNVA
RLKKEGKNAEAEALIEEGKRLGEEIKALEEKEKELQKKLNDLLLMIPNIPHESVPVGEDE
SQNVEVRRWGEPREFDFTPLAHWDLGPAWGLMDFSRASKLSGSRFTVMYGKLARLERALI
NFMLDVHTKEHGYTEVWVPHLVKRETITITGQLPKFEEELYLAERDDLFLIPTAEVPLAA
LHSGEILEEKELPKKYVSYTPCYRREAGSYGKDVRGMIRQHQFDKVELVWVTTPERSFED
LEELVKDAETILRKLELPYRVVSLCTGDLGFTSAKTYDIEVWLPSYNAYKEISSCSNVTD
FQARRGNMRYRRRSDGKLEYVHTLNGSGIAVGRALVAILENYQQPDGSVRVPEVLVPYTG
FEVIP

CDS  cDNA 1275 bp
   1 atgatagata taaagctcat cagacaaaat cccgatttcg tgaaggaagc cctcagaaag    60
  61 cgaggagagg atcccgctat aatcgatgag attttgaaga tcgacgccga ctggcgcgct   120
 121 accatcacga aaaccaacga gctgagatcc agaagaaacg aaatttccaa aaatgtggca   180
 181 aggttgaaaa aagaagggaa aaacgcagag gcagaggcac tcatcgagga agggaaaaga   240
 241 ttaggagaag agataaaagc gttagaagaa aaagaaaaag aacttcagaa gaagttaaac   300
 301 gatcttcttt tgatgattcc gaacatcccg catgagagtg tccccgttgg agaagacgaa   360
 361 tctcagaacg ttgaagtgag aaggtgggga gagccgagag aattcgactt caccccgctc   420
 421 gctcactggg acctcggacc tgcgtggggg ctcatggatt tcagcagggc gtccaagctc   480
 481 agcggttcca gattcaccgt tatgtatgga aaactcgcaa gactcgagag ggctctgata   540
 541 aacttcatgc ttgacgttca tacaaaggaa cacggttaca cggaagtgtg ggttccacac   600
 601 ctggtgaaaa gagaaaccat caccataacc ggacagctcc ccaaattcga agaagagctt   660
 661 tatcttgctg agagggatga cctgttcctc attccgacgg ctgaggttcc cctcgcagcg   720
 721 cttcacagtg gagagatcct cgaagagaaa gaactaccaa agaaatacgt ctcttacact   780
 781 ccctgttacc gcagagaagc gggaagttac gggaaagacg tgagggggat gatcaggcag   840
 841 catcaattcg acaaggtcga gctcgtctgg gtgaccacac cggaaagatc cttcgaagat   900
 901 cttgaagagc ttgtgaaaga cgccgaaacc attcttagaa aattggagct cccttacaga   960
 961 gtcgtttcgc tctgtacggg agatctcgga ttcacctccg cgaaaaccta cgatatagaa  1020
1021 gtgtggcttc cttcctacaa cgcatacaaa gagatatctt cctgcagtaa cgtgacggac  1080
1081 tttcaggcga gaagaggaaa catgagatac agaaggagat cggatggaaa gctcgaatac  1140
1141 gttcacacgt tgaacggatc gggtatcgcc gttggaaggg cactcgttgc gatactggaa  1200
1201 aactaccagc aaccagacgg cagtgtgaga gtgccggagg tgctcgttcc ctacacaggg  1260
1261 ttcgaggtga taccg  1275
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1396221 1397498 3 Glimmer3 score 14.3 good
Genemark probabilities .96   .99 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu