LOADING...
   TM1452;TM1452
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1452    TM1452            JCSG 283310 Proposed Target 01-OCT-12

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1452
DESCRIPTIONDNA primase (EC 2.7.7.-).
ORGANISMThermotoga maritima
COMMENT-!- FUNCTION: DNA PRIMASE IS THE POLYMERASE THAT SYNTHESIZES SMALL RNA
PRIMERS FOR THE OKAZAKI FRAGMENTS ON BOTH TEMPLATE STRANDS AT
REPLICATION FORKS DURING CHROMOSOMAL DNA SYNTHESIS.
-!- COFACTOR: BINDS ONE ZINC ION PER MOLECULE (BY SIMILARITY).
-!- SUBUNIT: MONOMER (BY SIMILARITY).
--------------------------------------------------------------------------
This SWISS-PROT entry is copyright. It is produced through a collaboration
between the Swiss Institute of Bioinformatics and the EMBL outstation -
the European Bioinformatics Institute. There are no restrictions on its
use by non-profit institutions as long as its content is in no way
modified and this statement is not removed. Usage by and for commercial
entities requires a license agreement (See http://www.isb-sib.ch/announce/
or send an email to license@isb-sib.ch).
--------------------------------------------------------------------------
DR UNIPROT; PRIM_THEMA
DR SPTR; Q9X1G3 (flat text); Q9X1G3 (good view)
DR GenBank; AAD36520
DR Pfam; PF01807; zf-CHC2;
DR Pfam; PF08275; Toprim_N;
DR Pfam; PF01751; Toprim;
DR Interpro; IPR006295; DNA_primase;
DR Interpro; IPR006171; Toprim_dom;
DR Interpro; IPR006647; Toprim_primase;
DR Interpro; IPR006154; Toprim_sub;
DR Interpro; IPR002694; Znf_CHC2;
DR PDB; 2AU3; Highly similar; 15-NOV-05; DNA PRIMASE;
DR KEGG; 2.7.7.; Enzyme page
DR FFAS; 283310; Fold and function assignment.
DR TVPC; TM1452; Homologs in PDB, JCSG and SG center.
DR OVP; TM1452; Ortholog view popup.
DR TPM; TM1452; Target PDB monitor.
DR FSS; TM1452; Target function coverage.
PROPERTY Residues: 565 aa
Molecule Weight: 65129.23 Dalton
Isoelectric Point: 7.05
Extinction Coefficient: 52260
Gravy Index: -.43
Number of Met residues: 8
Percentage of Met residues: 1.42 %
Number of Cys residues: 4
Percentage of Cys residues: 0.71 %
SEQUENCE  amino acids 565 aa
>TM1452  TM1452 DNA primase (dnaG)
MIPREVIEEIKEKVDIVEVISEYVNLTRVGSSYRALCPFHSETNPSFYVHPGLKIYHCFG
CGASGDVIKFLQEMEGISFQEALERLAKRAGIDLSLYRTEGTSEYGKYIRLYEETWKRYV
KELEKSKEAKDYLKSRGFSEEDIAKFGFGYVPKRSSISIEVAEGMNITLEELVRYGIALK
KGDRFVDRFEGRIVVPIKNDSGHIVAFGGRALGNEEPKYLNSPETRYFSKKKTLFLFDEA
KKVAKEVGFFVITEGYFDALAFRKDGIPTAVAVLGASLSREAILKLSAYSKNVILCFDND
KAGFRATLKSLEDLLDYEFNVLVATPSPYKDPDELFQKEGEGSLKKMLKNSRSFEYFLVT
AGEVFFDRNSPAGVRSYLSFLKGWVQKMRRKGYLKHIENLVNEVSSSLQIPENQILNFFE
SDRSNTMPVHETKSSKVYDEGRGLAYLFLNYEDLREKILELDLEVLEDKNAREFFKRVSL
GEDLNKVIENFPKELKDWIFETIESIPPPKDPEKFLGDLSEKLKIRRIERRIAEIDDMIK
KASNDEERRLLLSMKVDLLRKIKRR

CDS  cDNA 1695 bp
   1 gtgattcctc gagaggtcat cgaggaaata aaagaaaagg ttgacatcgt agaggtcatt    60
  61 tccgagtacg tgaatcttac ccgggtaggt tcctcctaca gggctctctg tccctttcat   120
 121 tcagaaacca atccttcttt ctacgttcat ccgggtttga agatatacca ttgtttcggc   180
 181 tgcggtgcga gtggagacgt catcaaattt cttcaagaaa tggaagggat cagtttccag   240
 241 gaagcgctgg aaagacttgc caaaagagct gggattgatc tttctctcta cagaacagaa   300
 301 gggacttctg aatacggaaa atacattcgt ttgtacgaag aaacgtggaa aaggtacgtc   360
 361 aaagagctgg agaaatcgaa agaggcaaaa gactatttaa aaagcagagg cttctctgaa   420
 421 gaagatatag caaagttcgg ctttgggtac gtccccaaga gatccagcat ctctatagaa   480
 481 gttgcagaag gcatgaacat aacactggaa gaacttgtca gatacggtat cgcgctgaaa   540
 541 aagggtgatc gattcgttga tagattcgaa ggaagaatcg ttgttccaat aaagaacgac   600
 601 agtggtcata ttgtggcttt tggtgggcgt gctctcggca acgaagaacc gaagtatttg   660
 661 aactctccag agaccaggta tttttcgaag aagaagaccc tttttctctt cgatgaggcg   720
 721 aaaaaagtgg caaaagaggt tggttttttc gtcatcaccg aaggctactt cgacgcgctc   780
 781 gcattcagaa aggatggaat accaacggcg gtcgctgttc ttggggcgag tctttcaaga   840
 841 gaggcgattc taaaactttc ggcgtattcg aaaaacgtca tactgtgttt cgataatgac   900
 901 aaagcaggct tcagagccac tctcaaatcc ctcgaggatc tcctagacta cgaattcaac   960
 961 gtgcttgtgg caaccccctc tccttacaaa gacccagatg aactctttca gaaagaagga  1020
1021 gaaggttcat tgaaaaagat gctgaaaaac tcgcgttcgt tcgaatattt tctggtgacg  1080
1081 gctggtgagg tcttctttga caggaacagc cccgcgggtg tgagatccta cctttctttc  1140
1141 ctcaaaggtt gggtccaaaa gatgagaagg aaaggatatt tgaaacacat agaaaatctc  1200
1201 gtgaatgagg tttcatcttc tctccagata ccagaaaacc agattttgaa cttttttgaa  1260
1261 agcgacaggt ctaacactat gcctgttcat gagaccaagt cgtcaaaggt ttacgatgag  1320
1321 gggagaggac tggcttattt gtttttgaac tacgaggatt tgagggaaaa gattctggaa  1380
1381 ctggacttag aggtactgga agataaaaac gcgagggagt ttttcaagag agtctcactg  1440
1441 ggagaagatt tgaacaaagt catagaaaac ttcccaaaag agctgaaaga ctggattttt  1500
1501 gagacaatag aaagcattcc tcctccaaag gatcccgaga aattcctcgg tgacctctcc  1560
1561 gaaaagttga aaatccgacg gatagagaga cgtatcgcag aaatagatga tatgataaag  1620
1621 aaagcttcaa acgatgaaga aaggcgtctt cttctctcta tgaaagtgga tctcctcaga  1680
1681 aaaataaaga ggagg  1695
Warning: the change of start codon from ATG/M to GTG/V;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1469178 1470875 -3 Glimmer3 score 12.91 good
Genemark probabilities .89   .96 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu