LOADING...
   TM1767;TM1767
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1767    TM1767            JCSG 283621 Crystal Hit 01-DEC-11

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1767
DESCRIPTIONMethylenetetrahydrofolate dehydrogenase (NADP+) (EC 1.5.1.5) /
Methenyltetrahydrofolate cyclohydrolase (EC 3.5.4.9)
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; FOLD_THEMA
DR SPTR; Q9X288 (flat text); Q9X288 (good view)
DR GenBank; AAD36831
DR Pfam; PF02882; THF_DHG_CYH_C;
DR Pfam; PF00763; THF_DHG_CYH;
DR Interpro; IPR000672; THFDhg/Cyc_hydro;
DR PDB; 3NGL; Highly similar; 20-APR-11; BIFUNCTIONAL PROTEIN FOLD;
DR PDB; 3NGX; Highly similar; 20-APR-11; BIFUNCTIONAL PROTEIN FOLD;
DR PDB; 2C2X; Highly similar; 13-OCT-05; METHYLENETETRAHYDROFOLATE DEHYDROGENASE- METHENYLTETRAHYDROF;
DR PDB; 2C2Y; Highly similar; 13-OCT-05; METHYLENETETRAHYDROFOLATE DEHYDROGENASE- METHENYLTETRAHYDROF;
DR PDB; 3L07; Highly similar; 22-DEC-09; BIFUNCTIONAL PROTEIN FOLD;
DR PDB; 3P2O; Highly similar; 13-OCT-10; BIFUNCTIONAL PROTEIN FOLD;
DR PDB; 4B4U; Highly similar; 22-AUG-12; BIFUNCTIONAL PROTEIN FOLD;
DR PDB; 4A5O; Highly similar; 16-NOV-11; BIFUNCTIONAL PROTEIN FOLD;
DR FFAS; 283621; Fold and function assignment.
DR TVPC; TM1767; Homologs in PDB, JCSG and SG center.
DR OVP; TM1767; Ortholog view popup.
DR TPM; TM1767; Target PDB monitor.
DR FSS; TM1767; Target function coverage.
PROPERTY Residues: 271 aa
Molecule Weight: 29555.7 Dalton
Isoelectric Point: 6.86
Extinction Coefficient: 9970
Gravy Index: -.06
Number of Met residues: 4
Percentage of Met residues: 1.48 %
Number of Cys residues: 4
Percentage of Cys residues: 1.48 %
SEQUENCE  amino acids 271 aa
>TM1767  TM1767 methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase (folD)
MWIDCKTIARSIEERTKERVEKLGFTPKLVSVACTDDPSALSYLKSQRKKAEKLGIAFEI
MNVSPEEIVSTLKKLGSDESVNGVFVARPFPLGLDEKEILSSVPVEKDVEGVNPANLGLL
LYDEEIFPPCTAEAAVRILERETNLSGKRVTVVGRSVTVGKPLALMLLKKGRDATVTVCH
SRTVNLEEITKNSDIVVVAVGRAHFLKKNMVKEGAIVIDVGINYVDGKLQGDVDPSVEEI
ARVTPVPGGVGQVTTALLFEHVVRAAERQRK

CDS  cDNA 813 bp
   1 gtgtggatcg actgtaagac aatagctcga agtatcgagg aaagaacgaa agagagagta    60
  61 gaaaagctcg gtttcactcc taaactggtc agcgttgcgt gtacagatga tccatcggcc   120
 121 ctttcttatc tgaaatctca gagaaaaaaa gctgagaaac tcggaatagc ctttgaaata   180
 181 atgaacgttt ctccagagga gatagtttcc acgctgaaga aactcggatc ggatgaaagt   240
 241 gtaaacggag ttttcgttgc aaggcctttt cctctggggc tcgacgagaa agaaatcctt   300
 301 tcctcagttc ccgttgaaaa agacgtcgaa ggtgtgaatc ctgcgaacct cggacttctt   360
 361 ctttacgacg aagagatctt tcctccatgc acggctgaag ccgctgtgag aatactcgaa   420
 421 agagagacaa acctctctgg aaaaagagtc accgttgttg gaagaagtgt caccgtggga   480
 481 aagccgctcg ctctgatgct cttgaagaaa ggaagggacg cgaccgtcac ggtttgtcac   540
 541 tccagaacgg tgaacctcga agagataaca aaaaacagcg acatcgtggt ggtagccgtc   600
 601 ggtagagcac actttttgaa gaagaacatg gtaaaagaag gagcgatcgt gatagacgtg   660
 661 gggataaatt acgtagacgg aaaactccag ggagatgtcg atccatcggt tgaagaaatc   720
 721 gccagagtga ctcccgttcc agggggtgtg ggacaggtaa cgaccgcact cctgttcgaa   780
 781 cacgttgtta gagcggcgga gagacaaagg aaa   813
Warning: the change of start codon from ATG/M to GTG/V;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1743699 1744514 3 Glimmer3 score 14.69 good
Genemark probabilities .93   .68 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu