LOADING...
   NP_418557.1;TT0126A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_418557.1    TT0126A            JCSG 405152 Protein Purification 09-NOV-06

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_418557.1
DESCRIPTIONgi|16131959|ref|NP_418557.1| transcriptional activator of cad operon [Escherichi
a coli K12]
ORGANISMESCHERICHIA COLI K12
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF00486; Trans_reg_C;
DR PDB; 3LY7; Identical; 09-FEB-11; TRANSCRIPTIONAL ACTIVATOR CADC;
DR PDB; 3LYA; Identical; 09-FEB-11; TRANSCRIPTIONAL ACTIVATOR CADC;
DR PDB; 3LY8; Identical; 09-FEB-11; TRANSCRIPTIONAL ACTIVATOR CADC;
DR PDB; 3LY9; Identical; 09-FEB-11; TRANSCRIPTIONAL ACTIVATOR CADC;
DR FFAS; 403990; Fold and function assignment.
DR TVPC; NP_418557.1; Homologs in PDB, JCSG and SG center.
DR OVP; TT0126A; Ortholog view popup.
DR TPM; NP_418557.1; Target PDB monitor.
DR FSS; NP_418557.1; Target function coverage.
PROPERTY Residues: 512 aa
Molecule Weight: 57809.85 Dalton
Isoelectric Point: 5.52
Extinction Coefficient: 77810
Gravy Index: -.2
Number of Met residues: 12
Percentage of Met residues: 2.34 %
Number of Cys residues: 3
Percentage of Cys residues: 0.59 %
SEQUENCE  amino acids 512 aa
>NP_418557.1  gi|16131959|ref|NP_418557.1| transcriptional activator of cad operon [Escherichia coli K12]
MQQPVVRVGEWLVTPSINQISRNGRQLTLEPRLIDLLVFFAQHSGEVLSRDELIDNVWKR
SIVTNHVVTQSISELRKSLKDNDEDSPVYIATVPKRGYKLMVPVIWYSEEEGEEIMLSSP
PPIPEAVPATDSPSHSLNIQNTATPPEQSPVKSKRFTTFWVWFFFLLSLGICVALVAFSS
LDTRLPMSKSRILLNPRDIDINMVNKSCNSWSSPYQLSYAIGVGDLVATSLNTFSTFMVH
DKINYNIDEPSSSGKTLSIAFVNQRQYRAQQCFMSIKLVDNADGSTMLDKRYVITNGNQL
AIQNDLLESLSKALNQPWPQRMQETLQKILPHRGALLTNFYQAHDYLLHGDDKSLNRASE
LLGEIVQSSPEFTYARAEKALVDIVRHSQHPLDEKQLAALNTEIDNIVTLPELNNLSIIY
QIKAVSALVKGKTDESYQAINTGIDLEMSWLNYVLLGKVYEMKGMNREAADAYLTAFNLR
PGANTLYWIENGIFQTSVPYVVPYLDKFLASE

CDS  cDNA 1539 bp
   1 atgcaacaac ctgtagttcg cgttggcgaa tggcttgtta ctccgtccat aaaccaaatt    60
  61 agccgcaatg ggcgtcaact tacccttgag ccgagattaa tcgatcttct ggttttcttt   120
 121 gctcaacaca gtggcgaagt acttagcagg gatgaactta tcgataatgt ctggaagaga   180
 181 agtattgtca ccaatcacgt tgtgacgcag agtatctcag aactacgtaa gtcattaaaa   240
 241 gataatgatg aagatagtcc tgtctatatc gctactgtac caaagcgcgg ctataaatta   300
 301 atggtgccgg ttatctggta cagcgaagaa gagggagagg aaataatgct atcttcgcct   360
 361 ccccctatac cagaggcggt tcctgccaca gattctccct cccacagtct taacattcaa   420
 421 aacaccgcaa cgccacctga acaatcccca gttaaaagca aacgattcac taccttttgg   480
 481 gtatggtttt ttttcctgtt gtcgttaggt atctgtgtag cactggtagc gttttcaagt   540
 541 cttgatacac gtcttcctat gagcaaatcg cgtattttgc tcaatccacg cgatattgac   600
 601 attaatatgg taaataaaag ttgtaacagc tggagttccc cgtatcagct ctcttacgcg   660
 661 ataggcgtgg gtgatttggt ggcgacatca cttaacacct tctccacctt tatggtgcat   720
 721 gacaaaatca actacaacat tgatgaaccg agcagttccg gtaaaacatt atctattgcg   780
 781 tttgttaatc agcgccaata ccgtgctcaa caatgcttta tgtcgataaa attggtagac   840
 841 aatgcagatg gttcaaccat gctggataaa cgttatgtca tcactaacgg taatcagctg   900
 901 gcgattcaaa atgatttact ggagagttta tcaaaagcgt taaaccaacc gtggccacaa   960
 961 cgaatgcagg agacgctcca gaaaattttg ccgcatcgtg gtgcgttatt aactaatttt  1020
1021 tatcaggcac atgattattt actgcatggc gatgataaat cattgaaccg tgccagtgaa  1080
1081 ttattaggtg agattgttca atcatcccca gaatttacct acgcgagagc agaaaaagca  1140
1141 ttagttgata tcgtgcgcca ttctcaacat cctttagatg aaaaacaatt agcagcactg  1200
1201 aacacagaaa tagataacat tgttacactg ccggaattga acaacctgtc cattatatat  1260
1261 caaataaaag cggtcagtgc tctggtaaaa ggtaaaacag atgagtctta ccaggcgata  1320
1321 aatactggca ttgatcttga aatgtcctgg ctaaattatg tgttgcttgg caaggtttat  1380
1381 gaaatgaagg ggatgaaccg ggaagcagct gatgcatatc tcaccgcctt taatttacgc  1440
1441 ccaggggcaa acacccttta ctggattgaa aatggtatat tccagacttc tgttccttat  1500
1501 gttgtacctt atctcgacaa atttcttgct tcagaataa  1539
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
4358419 4359957 -1 Glimmer3 score 5.18 poor
Genemark probabilities -   - -
GenemarkHMM class - -

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu