LOADING...
   YP_322606.1;TT0527A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_322606.1    TT0527A            JCSG 404770 Proposed Target 09-AUG-14

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_322606.1
DESCRIPTIONgi|75908310|ref|YP_322606.1| Small GTP-binding protein domain [Anabaena variabil
is ATCC 29413]
ORGANISMANABAENA VARIABILIS ATCC 29413
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF01926; MMR_HSR1;
DR FFAS; 404770; Fold and function assignment.
DR TVPC; YP_322606.1; Homologs in PDB, JCSG and SG center.
DR OVP; TT0527A; Ortholog view popup.
DR TPM; YP_322606.1; Target PDB monitor.
DR FSS; YP_322606.1; Target function coverage.
PROPERTY Residues: 637 aa
Molecule Weight: 71770.12 Dalton
Isoelectric Point: 5.69
Extinction Coefficient: 156300
Gravy Index: .02
Number of Met residues: 8
Percentage of Met residues: 1.26 %
Number of Cys residues: 3
Percentage of Cys residues: 0.47 %
SEQUENCE  amino acids 637 aa
>YP_322606.1  gi|75908310|ref|YP_322606.1| Small GTP-binding protein domain [Anabaena variabilis ATCC 29413]
MVRLKPWQWVVLAMPIASIMIFLLVSAGMQIHTWGISWIWAVFTLVFVAWRWLLVKWTQP
AIRQIEAALAEVKEELKSAVEDTTPSVSSDKTQQIEAALQEILTIAQGDRPIWEDWTTFW
QRCQDLVRAIALIYYPQVQYPLLNIYVPQAYGLIRGTVDDLDQWMQKLSPALNQVTIGQA
YQAYEVYRKLEPSARKVWRAWNWAQWLLNPVAAAANRATKGTTNQANQQLLVNLGQLLRE
AALNNLCRQAIALYSGTTVNISTATISTPTLPKTKTQTLENILAQAQPVEKVAQKPVNIL
LAGRTGAGKSSLINTIFQSNLAEVDVLPSTAEIQNYHWQTQDGETLNLLDTPGYEQVKRG
DLRDLVLEYATKADLLLLVTPVLDPALQMDVDFLQEIKTTVADIPAIAVVTQVDRLRPIR
EWQPPYDWELGNRPKEIAIREATEYRAKLLGDFCNLVIPVVTGDTKTGRLAWGIEALSLG
LIQAIAPAKQLRLARFLRNLEARTVAAAKIIDHYTLQMATTQGLTALLKSPVLQFISTIS
TGSPTLAYLLAEQIPVEQLPIVIGKLQMAYDLFSLLKTEESSTLNFDLLSLWPLLLENPT
TPDRNAWAFGHAVVEYWTQNLTVEQLRQRFDYYLQQV

CDS  cDNA 1914 bp
   1 atggtacgtt taaaaccgtg gcagtgggtg gtattggcaa tgccgatcgc ctccatcatg    60
  61 attttcttgt tagtatccgc agggatgcag attcatactt ggggaataag ttggatttgg   120
 121 gctgtgttta ccttggtatt tgtagcttgg cgttggttgt tggtgaaatg gacacaacca   180
 181 gccatccggc aaatagaagc tgcattagcc gaagttaaag aagaactcaa atctgcggtg   240
 241 gaggacacaa caccaagcgt cagcagtgat aagacacaac aaatagaagc agctttacaa   300
 301 gaaatcctga caattgccca aggcgatcgc ccgatttggg aagattggac aacattttgg   360
 361 caaagatgtc aagatttagt tagagcgatc gccctgattt attatcccca ggtgcagtat   420
 421 cccttactaa atatctacgt cccccaagct tacggattga ttcggggaac agtcgatgac   480
 481 ttagatcagt ggatgcagaa gttatcacca gcactcaatc aggtaacaat tgggcaagca   540
 541 taccaagcat acgaagtgta tcgcaaacta gaaccatcag cgcggaaggt ctggcgtgca   600
 601 tggaattggg cgcagtggtt gttaaatcct gtggctgcgg cggctaaccg ggcaactaaa   660
 661 ggcacaacta atcaagcaaa tcagcaatta ttggtaaatt tagggcaatt actgcgggaa   720
 721 gctgctttaa acaacttgtg tcgccaggcg atcgccctct acagtggaac tacagtcaat   780
 781 atctccacag ctaccatttc taccccaacc ttaccaaaaa ccaaaactca aacactagaa   840
 841 aacatcctcg cacaagccca accagtcgag aaagttgccc agaaacctgt aaatatttta   900
 901 ctggcaggaa gaacgggagc aggaaaaagc agtttaatta atacaatctt tcaaagtaat   960
 961 ttggcagaag tggatgtgtt acccagcacc gccgagattc aaaattacca ctggcaaacc  1020
1021 caagatgggg aaaccttgaa tctcttagat acaccaggat acgaacaagt caagcggggt  1080
1081 gacttacgag atttagtatt agaatatgcc accaaagccg acttattact gttagtcacc  1140
1141 cctgtacttg accccgcctt gcaaatggat gtggactttt tgcaagaaat caaaaccaca  1200
1201 gttgcagaca tccccgcgat cgctgtagtt acccaagtag atcgcctgcg tcccatccgt  1260
1261 gaatggcaac cgccttatga ttgggaattg ggtaacagac caaaggaaat tgccatccgc  1320
1321 gaagctacag agtatcgtgc taaattgtta ggagactttt gtaatctagt catacccgtt  1380
1381 gtcacaggtg atacaaaaac aggtagactt gcttggggaa tagaggcttt atccttggga  1440
1441 ttaatccagg cgatcgcccc agccaaacaa ctcagactcg cccgcttttt gcgtaaccta  1500
1501 gaagcccgta ctgtagctgc tgccaaaatc attgaccact acacattgca aatggcaacc  1560
1561 acccaaggat tgacagcatt actcaaaagt cctgtgcttc agttcatttc taccatttcc  1620
1621 actggttccc caactttagc ttacctacta gcagaacaaa tccccgtaga acagttaccc  1680
1681 atcgtcattg gtaaactgca aatggcttat gatttattct cactattaaa aacagaagaa  1740
1741 tccagcaccc tcaactttga cctcttatct ctatggccgc tacttttaga aaaccccacc  1800
1801 acacccgacc gcaacgcttg ggcttttggt catgcagtag ttgaatattg gactcaaaat  1860
1861 ttaacagttg aacaattgcg gcagcgtttc gactattatt tacagcaagt ttga  1914
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
2578953 2580866 -3 Glimmer3 score 12.61 good
Genemark probabilities .89   .17 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu