LOADING...
   BC075641;WT2414A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
BC075641    WT2414A.SMARCA2            JCSG 422831 Protein Purification 11-JUN-03

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONBC075641
DESCRIPTIONBC075641 Mus musculus SWI/SNF related, matrix associated, actin dependent regula
tor of chromatin, subfamily a, member 2, mRNA (cDNA clone MGC:93019 IMAGE:305440
92), complete cds, coding region:111-4844
ORGANISMMUS MUSCULUS
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF00176; SNF2_N;
DR Pfam; PF00439; Bromodomain;
DR Pfam; PF00271; Helicase_C;
DR Pfam; PF07529; HSA;
DR Pfam; PF07533; BRK;
DR Pfam; PF08880; QLQ;
DR PDB; 4QY4; Identical; 27-AUG-14; SMARCA2 PROTEIN;
DR PDB; 5DKC; Identical; 14-OCT-15; PROBABLE GLOBAL TRANSCRIPTION ACTIVATOR SNF2L2;
DR PDB; 2DAT; Identical; 02-JAN-07; POSSIBLE GLOBAL TRANSCRIPTION ACTIVATOR SNF2L2;
DR PDB; 2GRC; Identical; 08-MAY-07; PROBABLE GLOBAL TRANSCRIPTION ACTIVATOR SNF2L4;
DR PDB; 3UVD; Identical; 18-JAN-12; TRANSCRIPTION ACTIVATOR BRG1;
DR FFAS; 422830; Fold and function assignment.
DR TVPC; BC075641; Homologs in PDB, JCSG and SG center.
DR OVP; WT2414A.SMARCA2; Ortholog view popup.
DR TPM; BC075641; Target PDB monitor.
DR FSS; BC075641; Target function coverage.
PROPERTY Residues: 1577 aa
Molecule Weight: 180244.09 Dalton
Isoelectric Point: 6.76
Extinction Coefficient: 127090
Gravy Index: -.9
Number of Met residues: 47
Percentage of Met residues: 2.98 %
Number of Cys residues: 10
Percentage of Cys residues: 0.63 %
SEQUENCE  amino acids 1577 aa
>BC075641  BC075641 Mus musculus SWI/SNF related, matrix associated, actin dependent regulator of chromatin, su
MSTPTDPAAMPHPGPSPGPGPSPGPILGPSPGPGPSPGSVHSMMGPSPGPPSVSHPLSTM
GSADFPQEGMHQLHKPMDGIHDKGIVEDVHCGSMKGTSMRPPHPGMGPPQSPMDQHSQGY
MSPHPSPLGAPEHVSSPTPPQMPPSQPGALIPGDPQAMNQPNRGPSPFSPVQLHQLRAQI
LAYKMLARGQPLPETLQLAVQGKRTLPGMQQQQQQQQQQQQQQQQQQQQQQQQQQPQQPQ
QQAQAQPQQQQQQQQQPALVSYNRPSGPGQELLLSGQSAPQKLSAPAPSGRPSPAPQAAV
QPTATAVPGPSVQQPAPGQPSPVLQLQQKQSRISPIQKPQGLDPVEILQEREYRLQARIA
HRIQELESLPGSLPPDLRTKATVELKALRLLNFQRQLRQEVVACMRRDTTLETALNSKAY
KRSKRQTLREARMTEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSVAGKIQK
LSKAVATWHANTEREQKKETERIEKERMRRLMAEDEEGYRKLIDQKKDRRLAYLLQQTDE
YVANLTNLVWEHKQAQAAKEKKKRRRRKKKAEENAEGGEPALGPDGEPIDESSQMSDLPV
KVTHTETGKVLFGPEAPKASQLDAWLEMNPGYEVAPRSDSEESESDYEEEDEEEESSRQE
TEEKILLDPNSEEVSEKDAKQIIETAKQDVDDEYSMQYSARGSQSYYTVAHAISERVEKQ
SALLINGTLKHYQLQGLEWMVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRLNGP
YLIIVPLSTLSNWTYEFDKWAPSVVKISYKGTPAMRRSLVPQLRSGKFNVLLTTYEYIIK
DKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRILLTGTPLQNKLPELWALL
NFLLPTIFKSCSTFEQWFNAPFAMTGERVDLNEEETILIIRRLHKVLRPFLLRRLKKEVE
SQLPEKVEYVIKCDMSALQKILYRHMQAKGILLTDGSEKDKKGKGGAKTLMNTIMQLRKI
CNHPYMFQHIEESFAEHLGYSNGVINGAELYRASGKFELLDRILPKLRATNHRVLLFCQM
TSLMTIMEDYFAFRNFLYLRLDGTTKSEDRAALLKKFNEPGSQYFIFLLSTRAGGLGLNL
QAADTVVIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVD
QKVIQAGMFDQKSSSHERRAFLQAILEHEEENEEEDEVPDDETLNQMIARREEEFDLFMR
MDMDRRREDARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKIFGRGSRQRRDVD
YSDALTEKQWLRAIEDGNLEEMEEEVRLKKRKRRRNVDKDPVKEDVEKAKKRRGRPPAEK
LSPNPPKLTKQMNAIIDTVINYKDSSGRQLSEVFIQLPSRKDLPEYYELIRKPVDFKKIK
ERIRNHKYRSLGDLEKDVMLLCHNAQTFNLEGSQIYEDSIVLQSVFKSARQKIAKEEESE
EESNEEEEEDDEEESESEAKSVKVKIKLNKKEEKGRDTGKGKKRPNRGKAKPVVSDFDSD
EEQEENEQSEASGTDNE

CDS  cDNA 4734 bp
   1 atgtccacac ccacagaccc agcagcaatg ccccatcctg ggccctcccc ggggcctgga    60
  61 ccctctcctg gaccaattct ggggcctagt ccaggaccag gaccatcccc aggttctgtg   120
 121 cacagcatga tgggtcctag tcccggacct cccagcgtct cacatcctct gtcaacgatg   180
 181 ggctctgcag acttcccaca ggaaggcatg caccaattac ataagcccat ggatgggata   240
 241 catgacaaag ggattgtaga agatgtccac tgtggatcca tgaagggcac cagcatgcgc   300
 301 cccccacacc caggaatggg ccctccacag agccccatgg accagcacag ccaaggttat   360
 361 atgtcaccac atccgtctcc tctgggagcc ccggagcacg tctctagccc aaccccaccc   420
 421 cagatgccac cgagccagcc aggggcactc atcccaggag atccgcaggc catgaaccag   480
 481 cctaacagag gtccctcgcc tttcagtcct gtgcagctgc atcagcttcg agctcagatt   540
 541 ttagcttaca aaatgttggc caggggccag cctctccctg aaactctgca gctggcagtc   600
 601 cagggaaaaa ggaccttgcc tggcatgcag cagcagcagc agcaacaaca acaacagcag   660
 661 cagcagcagc agcagcagca gcagcaacag cagcaacaac agcagcccca gcagcctcag   720
 721 cagcaggctc aggcacagcc ccagcagcag cagcaacagc agcagcagcc agctcttgtt   780
 781 agctataatc gaccatctgg ccccgggcag gagctgctac tgagtggcca gagcgctccg   840
 841 cagaagctgt cagcaccagc accaagcggc cgaccttcac cggcacccca ggccgccgtc   900
 901 cagcccacgg ccacagcggt gcccgggccc tccgtgcagc agcccgcccc agggcagccg   960
 961 tctccggtcc tacagctgca acagaagcag agccgcatca gccccatcca gaaaccgcaa  1020
1021 ggcctggacc cggtggagat cctgcaggaa cgagagtaca gacttcaagc tcgcatcgct  1080
1081 cataggatac aagaactgga aagtctgcct ggttccttgc caccagattt acgcaccaaa  1140
1141 gcaaccgtgg aactgaaagc acttcgctta ctcaacttcc aacgtcagct gagacaggag  1200
1201 gtggtggcct gcatgcggag ggacaccacc ctggagacgg ccctcaactc caaagcatat  1260
1261 aagcggagca agcgccagac cctgcgtgag gcacgcatga cagagaaact ggagaagcag  1320
1321 cagaagatag aacaggagag gaaacgccgg cagaaacacc aggaatacct gaacagtatt  1380
1381 ttgcaacatg caaaagattt taaggaatat caccggtctg tggccgggaa gatccagaag  1440
1441 ctctccaaag cagtggcgac ttggcatgct aacacagaaa gggagcagaa gaaggagacg  1500
1501 gagcggatcg agaaggagag aatgcggagg ctgatggccg aagatgaaga gggctacagg  1560
1561 aagcttattg accaaaagaa agacagacgt ctcgcctacc tattgcagca gaccgatgag  1620
1621 tatgtcgcca atctgaccaa cctggtgtgg gagcacaagc aggcccaagc agccaaagag  1680
1681 aagaagaaga ggaggaggag gaagaagaag gctgaagaga atgcagaggg aggggaacct  1740
1741 gccctgggac cagatggaga gccaatagat gaaagcagcc agatgagtga cctgcctgtc  1800
1801 aaagtgacac acacagaaac tggcaaggtc ctctttggac cagaagcacc caaagcaagt  1860
1861 cagctggatg cctggctgga gatgaatcct ggttacgaag ttgcacccag atctgacagt  1920
1921 gaagagagtg aatcggacta cgaggaggag gatgaagaag aagagtccag taggcaggaa  1980
1981 accgaggaga agatactgct ggatcccaac agtgaagaag tttccgaaaa ggatgccaag  2040
2041 cagatcattg agactgcgaa gcaggacgtg gacgacgaat acagcatgca gtacagtgcc  2100
2101 agaggctctc agtcctacta cacggtggct cacgctatct ctgagagggt ggagaagcag  2160
2161 tctgccctcc tcattaacgg caccctaaag cattaccagc tccagggcct ggaatggatg  2220
2221 gtttccctgt ataataacaa tctgaacgga atcttagctg atgaaatggg gctaggcaag  2280
2281 accatccaga ccattgcact catcacgtat ctgatggagc acaaaaggct caatggtccc  2340
2341 tacctcatca tcgtccccct ctcgactctg tctaactgga catatgaatt tgacaaatgg  2400
2401 gctccttctg tggtgaaaat ttcttacaag ggtacccctg ccatgcgacg ctccctcgtt  2460
2461 ccccagctac ggagtggcaa attcaatgtc ctcctgacta cttacgagta cattataaaa  2520
2521 gacaagcaca ttcttgcaaa gattcggtgg aagtacatga tcgtggacga aggccaccgg  2580
2581 atgaagaatc accactgcaa gctaacccag gtcctgaaca cacactatgt ggcccccagg  2640
2641 cggatccttc tgactgggac cccactgcag aataagcttc cggaactctg ggccctcctc  2700
2701 aacttcctcc tccctacaat cttcaagagt tgcagcacat ttgagcagtg gtttaatgct  2760
2761 ccatttgcca tgaccggtga aagggtggac ctgaacgaag aagaaacgat tttgatcatc  2820
2821 aggcgtctac acaaggtgct gagacccttt ttactgagga ggctgaagaa agaggttgag  2880
2881 tctcagcttc cggaaaaggt tgagtatgtg atcaagtgtg acatgtcagc tctgcagaag  2940
2941 attctgtacc gtcacatgca agccaagggg atcctcctca cggacgggtc tgagaaagat  3000
3001 aagaagggga aaggaggtgc caagacactt atgaacacca tcatgcagct gagaaaaata  3060
3061 tgcaaccacc catatatgtt tcagcacatt gaggaatcct ttgctgaaca cctgggctat  3120
3121 tcgaatgggg tcatcaatgg ggctgagctg tatcgggcct cgggaaagtt tgagctgctt  3180
3181 gatcgtattc tgcccaaatt gagagcgact aaccaccgcg tgctgctttt ctgccagatg  3240
3241 acgtcactca tgaccattat ggaggattac tttgcttttc ggaacttcct gtacctgcgc  3300
3301 cttgacggca ccaccaagtc tgaagatcgt gctgctttgc taaagaagtt caatgaacct  3360
3361 gggtcccagt atttcatttt cttgctgagc acaagagcag ggggcctggg cttaaatctt  3420
3421 caggcggcag acacggtggt catatttgac agcgactgga atcctcacca ggatctgcag  3480
3481 gcccaagacc gagctcaccg cattggccaa caaaacgagg tccgggtgct gaggctttgc  3540
3541 accgtcaaca gtgtggagga aaagattctc gcggctgcca agtacaagct gaacgtggat  3600
3601 cagaaggtta tccaagcagg catgtttgac cagaagtcat ccagccacga gcggagggcc  3660
3661 ttcctgcagg ccattctgga gcacgaggag gagaatgagg aagaagatga ggtaccagac  3720
3721 gacgagaccc tgaaccagat gattgctcgc cgggaggaag aatttgatct ttttatgcgc  3780
3781 atggacatgg accggcggag ggaggatgcc cggaacccga agcgcaaacc ccgcttgatg  3840
3841 gaggaagatg agctgccctc ctggattatc aaggatgacg ccgaagtgga aaggctcacc  3900
3901 tgtgaagaag aggaggagaa gatatttggg aggggctctc gccagcgccg ggatgtggac  3960
3961 tacagtgatg ccctcaccga gaagcaatgg ctcagggcca tcgaagacgg caatttggaa  4020
4021 gaaatggaag aggaggtacg gcttaagaag agaaaaagac gaagaaatgt ggataaagac  4080
4081 cccgtgaagg aagatgtgga aaaagcgaag aaaagaagag gccgccctcc ggctgagaag  4140
4141 ttgtcaccaa atcccccaaa actaacgaag cagatgaacg ccatcattga tactgtgata  4200
4201 aactacaaag acagttcagg gcgacagctc agtgaagtct tcattcagtt accttccagg  4260
4261 aaagacttac cagaatacta tgaattaatt aggaagccag tggatttcaa aaagataaag  4320
4321 gagcgaatcc gtaatcataa gtatcggagc ctgggagacc tggagaaaga cgtcatgctt  4380
4381 ctctgtcaca acgcacagac attcaacttg gaaggatccc agatctacga agactccatt  4440
4441 gtcctacagt cagtgtttaa gagtgctcgg cagaaaattg ccaaagaaga agagagtgag  4500
4501 gaagaaagca atgaagaaga ggaagaagat gatgaagagg agtcggagtc agaggcgaaa  4560
4561 tctgtgaagg tgaaaatcaa gctgaataaa aaggaagaga aaggccggga cacagggaag  4620
4621 ggcaagaagc ggccaaaccg aggcaaagcc aaacccgtcg tgagcgattt tgacagtgac  4680
4681 gaggaacagg aagagaacga acagtcagaa gcaagtggaa ctgataacga gtga  4734
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu