LOADING...
   NP_344555.1;NP_344555.1
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_344555.1    XB5465A            JCSG 358603 PDB Deposition 05-AUG-31              PDB id: 2awa

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_344555.1
DESCRIPTIONDNA polymerase III, beta chain (EC 2.7.7.7).
ORGANISMStreptococcus pneumoniae tigr4
COMMENT-!- FUNCTION: DNA polymerase III is a complex, multichain enzyme
responsible for most of the replicative synthesis in bacteria.
This DNA polymerase also exhibits 3' to 5' exonuclease activity.
The beta chain is required for initiation of replication once it
is clamped onto DNA, It slides freely (bidirectional and ATP-
independent) along duplex DNA (By similarity).
-!- CATALYTIC ACTIVITY: N deoxynucleoside triphosphate = N diphosphate
+ {DNA}(N).
-!- SUBUNIT: DNA polymerase III contains a core (composed of alpha,
epsilon and theta chains) that associates with a tau subunit. This
core dimerizes to form the POLIII' complex. PolIII' associates
with the gamma complex (composed of gamma, delta, delta', psi and
chi chains) and with the beta chain to form the complete DNA
polymerase III complex (By similarity).
-!- SUBCELLULAR LOCATION: Cytoplasmic (By similarity).
--------------------------------------------------------------------------
This Swiss-Prot entry is copyright. It is produced through a collaboration
between the Swiss Institute of Bioinformatics and the EMBL outstation -
the European Bioinformatics Institute. There are no restrictions on its
use as long as its content is in no way modified and this statement is not
removed.
--------------------------------------------------------------------------
DR UNIPROT; DPO3B_STRPN
DR SPTR; O06672 (flat text); O06672 (good view)
DR GenBank; NP_344555
DR Pfam; PF02767; DNA_pol3_beta_2;
DR Pfam; PF02768; DNA_pol3_beta_3;
DR Pfam; PF00712; DNA_pol3_beta;
DR Interpro; IPR001001; DNA_polIII_beta;
DR PDB; 2AWA; Identical; 20-SEP-05; DNA POLYMERASE III, BETA CHAIN;
DR PDB; 2AVT; Highly similar; 24-JAN-06; DNA POLYMERASE III BETA SUBUNIT;
DR PDB; 4TR6; Highly similar; 10-SEP-14; DNA POLYMERASE III SUBUNIT BETA;
DR KEGG; 2.7.7.7; Enzyme page
DR FFAS; 358603; Fold and function assignment.
DR TVPC; NP_344555.1; Homologs in PDB, JCSG and SG center.
DR OVP; XB5465A; Ortholog view popup.
DR TPM; NP_344555.1; Target PDB monitor.
DR FSS; NP_344555.1; Target function coverage.
PROPERTY Residues: 378 aa
Molecule Weight: 42070.4 Dalton
Isoelectric Point: 5.04
Extinction Coefficient: 5960
Gravy Index: -.11
Number of Met residues: 3
Percentage of Met residues: 0.79 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 378 aa
>NP_344555.1  gi|15899951|ref|NP_344555.1| DNA polymerase III, beta subunit [Streptococcus pneumoniae TIGR4]
MIHFSINKNLFLQALNTTKRAISSKNAIPILSTVKIDVTNEGITLIGSNGQISIENFISQ
KNEDAGLLITSLGSILLEASFFINVVSSLPDVTLDFKEIEQNQIVLTSGKSEITLKGKDS
EQYPRIQEISASTPLILETKLLKKIINETAFAASTQESRPILTGVHFVLSQHKELKTVAT
DSHRLSQKKLTLEKNSDDFDVVIPSRSLREFSAVFTDDIETVEIFFANNQILFRSENISF
YTRLLEGNYPDTDRLIPTDFNTTITFNVVNLRQSMERARLLSSATQNGTVKLEIKDGVVS
AHVHSPEVGKVNEEIDTDQVTGEDLTISFNPTYLIDSLKALNSEKVTISFISAVRPFTLV
PADTDEDFMQLITPVRTN

CDS  cDNA 1137 bp
   1 atgattcatt tttcaattaa taaaaattta tttctacaag cattaaatac tactaagaga    60
  61 gctattagtt ctaaaaatgc cattcctatt ttatcaacag taaaaattga cgtgaccaat   120
 121 gaaggtatta ctttaattgg ttcaaatggt caaatttcaa ttgaaaattt tatttctcaa   180
 181 aaaaatgaag atgctggttt gttaattact tctttaggtt cgatccttct tgaagcttct   240
 241 ttctttatca atgtagtatc tagtttacct gatgtaactc ttgattttaa agaaattgaa   300
 301 caaaatcaaa ttgttttaac cagtggcaaa tcagaaatta ccctaaaagg aaaagatagc   360
 361 gaacaatatc cacgaatcca agaaatttca gcaagcactc ctttaatact tgaaacaaaa   420
 421 ttactcaaga aaattattaa tgaaacagcc tttgctgcaa gtacacaaga gagtcgtccg   480
 481 attttaacag gtgtccactt cgtattgagt caacacaaag agttaaaaac agttgcaaca   540
 541 gactctcatc gcctaagcca gaaaaaattg actcttgaaa aaaatagtga tgattttgat   600
 601 gtcgtaattc ctagccgttc tctacgcgaa ttttcagcgg tatttacaga tgatatcgaa   660
 661 actgtagaga ttttctttgc caataaccaa atcctcttta gaagcgaaaa tattagcttc   720
 721 tatactcgtc tcctagaagg aaactatcct gatacagatc gcttgattcc aacagacttt   780
 781 aacactacta ttacttttaa tgtggtaaac ttacgccagt caatggagcg tgcccgtctt   840
 841 ttatcaagtg cgactcaaaa tggtactgtg aaacttgaaa ttaaggatgg ggttgttagc   900
 901 gcccatgttc actctccaga agttggtaaa gtaaacgaag aaatcgatac tgatcaggtt   960
 961 actggtgaag atttgaccat tagtttcaac ccaacttact tgattgattc tcttaaagct  1020
1021 ttaaatagcg aaaaggtgac tattagcttt atctcagctg ttcgtccatt tactcttgtg  1080
1081 ccagcagata ctgacgaaga cttcatgcag ctcattacac cagttcgtac aaattaa  1137
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1717 2853 1 Glimmer3 score 9 poor
Genemark probabilities .89   - good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu