TM0001;TM0001 |
Protein Sequence Comparative Analysis (PSCA) | |
![]() |
|
TM0001 TM0001 JCSG 281882 Protein Purification 04-JUL-20 Protein Sequence Information ![]() ![]()
SEQUENCE amino acids 41 aa >TM0001 TM0001 hypothetical protein MVYGKEGYGRSKNILLSECVCGIISLELNGFQYFLRGMETL CDS cDNA 123 bp 1 atggtttatg gaaaggaagg atatggaagg tcaaaaaaca tcttgctttc agagtgtgtt 60 61 tgtggtataa tttctcttga actcaacggg tttcaatact tccttagagg tatggaaact 120 121 ctg 123Target constructs Download sequence in PIR or FASTA format Chemical properties of sequence with tag
Notes The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951). Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function. |