TM0004;TM0004 |
Protein Sequence Comparative Analysis (PSCA) | |
![]() |
|
TM0004 TM0004 JCSG 281885 Protein Purification 04-JUL-19 Protein Sequence Information ![]() ![]()
SEQUENCE amino acids 31 aa >TM0004 TM0004 hypothetical protein MKDLYERFNNSLEVWKLVELFGTSIRIHLFQ CDS cDNA 93 bp 1 atgaaagatt tgtatgaacg tttcaataat tccttagagg tatggaaact tgtcgaactc 60 61 tttggtactt ccatccggat acatctgttt caa 93Target constructs Download sequence in PIR or FASTA format Chemical properties of sequence with tag
Notes The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951). Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function. |