LOADING...
   TM0012;TM0012
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0012    TM0012            JCSG 281893 Crystal Hit 02-NOV-01

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0012
DESCRIPTIONNADH dehydrogenase I chain E (EC 1.6.99.5)
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9WXM7_THEMA
DR SPTR; Q9WXM7 (flat text); Q9WXM7 (good view)
DR GenBank; AAD35106
DR Pfam; PF01257; 2Fe-2S_thioredx;
DR Interpro; IPR002023; Cmplx1_24kDa;
DR PDB; 2FUG; Highly similar; 14-FEB-06; NADH-QUINONE OXIDOREDUCTASE CHAIN 1;
DR PDB; 3I9V; Highly similar; 15-SEP-09; NADH-QUINONE OXIDOREDUCTASE SUBUNIT 1;
DR PDB; 3IAM; Highly similar; 15-SEP-09; NADH-QUINONE OXIDOREDUCTASE SUBUNIT 1;
DR PDB; 3IAS; Highly similar; 15-SEP-09; NADH-QUINONE OXIDOREDUCTASE SUBUNIT 1;
DR PDB; 3M9S; Highly similar; 26-MAY-10; NADH-QUINONE OXIDOREDUCTASE SUBUNIT 1;
DR PDB; 2YBB; Highly similar; 19-OCT-11; NADH-QUINONE OXIDOREDUCTASE SUBUNIT 1;
DR PDB; 4HEA; Highly similar; 13-FEB-13; NADH-QUINONE OXIDOREDUCTASE SUBUNIT 1;
DR KEGG; 1.6.99.5; Enzyme page
DR FFAS; 281893; Fold and function assignment.
DR TVPC; TM0012; Homologs in PDB, JCSG and SG center.
DR OVP; TM0012; Ortholog view popup.
DR TPM; TM0012; Target PDB monitor.
DR FSS; TM0012; Target function coverage.
PROPERTY Residues: 176 aa
Molecule Weight: 19957.02 Dalton
Isoelectric Point: 5.32
Extinction Coefficient: 11920
Gravy Index: -.25
Number of Met residues: 5
Percentage of Met residues: 2.84 %
Number of Cys residues: 4
Percentage of Cys residues: 2.27 %
SEQUENCE  amino acids 176 aa
>TM0012  TM0012 NADP-reducing hydrogenase, subunit A (hndA-1)
MKKFPINSDQEVAVLVKSKEELFKELENFIEENGYEGKKDALIQVLHKAQELFGYLPADV
LEYISDKLDVPLSKVYGVVTFYNFFSTKPKGKHQIKVCLGTACYVKGADRIFERFLEELK
VNPDEPTSDGMFSVHGVRCLGACSMAPVVMVDEDDFYGRVTPDMVPQIISKYKREG

CDS  cDNA 528 bp
   1 gtgaaaaaat tcccgataaa ttctgatcag gaggtggcgg ttttggtcaa gtcgaaggag    60
  61 gaactcttca aagagctgga gaatttcata gaagaaaatg ggtacgaggg aaagaaggat   120
 121 gcactcatac aggtgcttca caaggcccag gaactcttcg gatatcttcc cgcggatgtt   180
 181 ctcgagtaca tctcagacaa actcgacgtt cctctctcga aggtttatgg agtggtcacc   240
 241 ttctacaact tcttctccac aaagccaaag ggtaaacatc agatcaaggt ttgtctcggt   300
 301 accgcgtgtt acgtgaaggg tgcggacaga atcttcgaaa gattcctcga agaactcaag   360
 361 gtgaatccgg atgaacccac cagcgatggt atgttctccg ttcacggtgt gagatgcctc   420
 421 ggggcgtgca gtatggcacc ggttgtcatg gtggatgaag acgattttta cggcagagta   480
 481 actcccgata tggtgcctca gatcatcagt aagtacaagc gggaggga   528
Warning: the change of start codon from ATG/M to GTG/V;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
10855 11385 -1 Glimmer3 score - -
Genemark probabilities .86   .27 poor
GenemarkHMM class - -

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu