TM0016;TM0016 |
Protein Sequence Comparative Analysis (PSCA) | |
![]() |
|
TM0016 TM0016 JCSG 281897 Protein Purification 04-JUL-20 Protein Sequence Information ![]() ![]()
SEQUENCE amino acids 101 aa >TM0016 TM0016 pyruvate ferredoxin oxidoreductase, delta subunit (porD) MRMSLKSWKEIPIGGVIDKPGTAREYKTGAWRVMRPILHKEKCIDCMFCWLYCPDQAIIQ EGGIMKGFNYDYCKGCGLCANVCPKQAIEMRPETEFLSEEG CDS cDNA 303 bp 1 gtgagaatgt ctcttaaaag ctggaaggaa attcccattg gaggagtcat cgacaaaccg 60 61 ggaacagcaa gagaatacaa aacaggtgcc tggcgtgtga tgagacctat tcttcacaaa 120 121 gagaaatgta tagactgtat gttctgctgg ctctactgtc cagatcaagc gatcatccaa 180 181 gaaggcggaa taatgaaagg tttcaactac gactactgta aaggatgcgg actctgtgcg 240 241 aacgtatgtc caaagcaggc catagagatg agacctgaga ctgagtttct gagcgaggag 300 301 gga 303Warning: the change of start codon from ATG/M to GTG/V; Target constructs Download sequence in PIR or FASTA format Chemical properties of sequence with tag
Notes The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951). Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function. |